معلومة

التوافق بين إصدارات spytag / spycatcher

التوافق بين إصدارات spytag / spycatcher


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

خلفية

SpyTag و SpyCatcher عبارة عن ببتيدات يمكن أن ترتبط عبر رابطة أميد عفوية. لهذا السبب ، يمكن دمجها مع البروتينات ذات الأهمية كعلامات لتسبب ارتباط البروتينات. يوجد (حاليًا) ثلاثة إصدارات من نظام spytag-spycatcher ، حيث يحتوي كل نظام على إصدار مختلف من spytag و catcher (أي يحتوي النظام 1 على spytag1 و spycatcher1 ، ويحتوي system2 على spytag2 و spycatcher2 ، ويحتوي system3 على spytag3 و spycatcher3).

سؤال

سؤالي هو ، ما مدى توافق spytag و spycatchers بين الإصدارات المختلفة؟ لذا ، على سبيل المثال ، هل يرتبط spytag1 مع spycatcher2؟

بحث مسبق

لقد وجدت البيان التالي من هذه الورقة:

أظهرت المتغيرات الجديدة توافقًا عكسيًا ، وتتفاعل بكفاءة مع الإصدارات الأبوية (SpyTag002 مع SpyCatcher: 1.0 ± 0.06 × 104 م − 1 ثانية − 1 ؛ SpyTag مع SpyCatcher002: 5.5 ± 0.03 × 103 م −1 ثانية − 1 ؛ ...

لكن هذه الأرقام لا تعني الكثير بالنسبة لي. هل تتوقع أن ترى ارتباطًا شبه كامل كما هو الحال مع spytag2-spycatcher2؟


لقد عملت مع اقتران SpyCatchers و SpyTags من التكرارات المختلفة ويمكنني أن أؤكد أنها كلها متوافقة مع الإصدارات السابقة. بينما تتمتع أزواج SpyCatcher003 و SpyTag003 بأسرع معدل رد فعل ، فإن تفاعلات جميع الأزواج (بما في ذلك SpyCatcher و SpyTag الإصدار 1) يجب أن تكتمل في ظل الظروف المناسبة.

إن SpyCatcher002-SpyTag1 ليس استثناء. كما نقلت في ورقة Angewandte Chemie ، فإن معدل التفاعل هو 5.5 × 103 م−1 س−1. معدل = ك [أ] [ب]. هذا يعني أن 10 ميكرومتر من SpyCatcher002 و 10 ميكرومتر من SpyTag سوف تتفاعل مع1/2 (50٪ اقتران) لمدة 18 ثانية عند درجة الحموضة = 7.0. ومع ذلك ، فإن 10 ميكرومتر من SpyCatcher002 و 10 ميكرومتر من SpyTag2 سوف ر1/2 5 ثوانٍ (ثابت المعدل هو 2x104 م−1 س−1). إذا كنت تتفاعل 0.1 ميكرومتر من كل منهما ، فإن t الخاص بهما1/2ق حوالي 8 و 33 دقيقة ، على التوالي.

للحصول على رد الفعل حتى اكتماله (اقتران> 90٪) ، ستحتاج إلى الانتظار حوالي 12 مرة طوال فترة1/2 (منذ كل ر1/2 يتضاعف في رد فعل من الدرجة الثانية). سيعتمد هذا بالطبع على تركيزك. ومع ذلك ، عند استخدام تركيزات منخفضة (0.1 ميكرومتر) ، فإن الاقتران الكامل لـ SpyCatcher002 بـ SpyTag002 سيستغرق 1.5 ساعة ، بينما سيستغرق SpyCatcher002 مع SpyTag 7 ساعات عند 25 درجة مئوية. سيستغرق SpyCatcher002 إلى SpyTag1 3 أضعاف المدة حتى يكتمل ؛ لذلك ، أوصي باستخدام ما لا يقل عن 1-2 ميكرومتر مما تريد مقترنًا تمامًا بكمية زائدة مساوية أو 2-4x إما من Tag أو Catcher وتشغيل التفاعل بين عشية وضحاها. يجب أن تكتمل التركيزات الأعلى (> = 10 ميكرومتر لكل من Tag و Catcher) في غضون 30 دقيقة إلى ساعة واحدة. عند إجراء تفاعلات اقتران لأكثر من بضع ساعات ، أوصيك بإجراءها عند 4C. يجب أن يسمح لك تحميل 10 ميكرولتر من 1-2 ميكرومتر من البروتين الخاص بك برؤية تحول النطاق على هلام SDS-PAGE مع صبغة كوماسي.

من واقع خبرتي ، تعتبر درجة الحرارة ودرجة الحموضة من العوامل المهمة عند إجراء الاقتران. يميل الرقم الهيدروجيني> 8.0 إلى تقليل معدل التفاعل بشكل كبير ، كما يفعل دفع درجة الحرارة لأعلى من 37 درجة مئوية (يفضل البروتين 25 درجة مئوية ودرجة الحموضة = 6.0). معظم التفاعلات التي أجريها في المختبر تكون عند 4 درجات مئوية خلال الليل عند درجة الحموضة = 7.4 بين SpyCatcher003 و SpyTag1 ، وقد اكتمل الاقتران تقريبًا. ومع ذلك ، فقد عمل آخرون في مختبرنا على نطاق واسع مع تفاعلات SpyCatcher002 و SpyTag1 ، والتي تميل أيضًا إلى الاكتمال في ظل الظروف المناسبة. علاوة على ذلك ، في بعض الأحيان ، يؤدي البروتين الذي يتم دمج SpyTag إليه إلى تغيير حركية التفاعل ، وقد تؤدي الروابط القصيرة إلى SpyTag إلى تقليل كفاءة الاقتران.

في حين أن الآخرين مؤهلون أكثر للإجابة على هذا السؤال ، نأمل أن يمنحك هذا معلومات كافية للعمل معهم!


أنا أعمل حاليًا مع هذه العلامات ، لذا خرجت من التجربة هنا. كفاءة الربط ليست 100٪ حتى عند خلط الإصدارات الصحيحة ، على سبيل المثال الإصدار 2 spytag والإصدار 2 spycatcher. أعتقد أن هذه هي الورقة الأصلية (https://pubs.acs.org/doi/pdf/10.1021/ja910795a) أبلغت عن كفاءة ربط بنسبة 60 ٪ بعد ساعة (أفترض للإصدار 1) وهذه الورقة (https: // www.pnas.org/content/pnas/109/12/E690.full.pdf) كشف 40 ٪ من كفاءة الربط في الدقيقة الأولى (غير واضح ما إذا كان الإصدار 1 أو 2 ولكني أفترض 1). من حيث بين الإصدارات ، لا يمكنني التحدث إلا عن خطأ ارتكبته مرة واحدة عن طريق مزج الإصدار 1 spycatcher بطريق الخطأ مع الإصدار 2 spytag. كان هناك ارتباط مرئي يمكن رؤيته بواسطة SDS-PAGE ومع ذلك ، كان ضعيفًا جدًا ويتطلب كميات كبيرة من البروتين لعرضه (حوالي 10 مجم / مل). لم أقم مطلقًا بأي نوع من القياسات الكمية حول كفاءة الربط لأنها كانت خطأ. ولكن من التجارب اللاحقة التي تم تشغيلها بشكل صحيح ، كان بإمكاني أن أرى أنها كانت أقل بكثير ، لذا سأستخدم دائمًا الإصدار 2 مع 2 والإصدار 3 مع 3 وما إلى ذلك حيث تم تصميمهما لتحقيق أقصى قدر من كفاءة الربط.


كواشف اقتران البروتين SpyTag / SpyCatcher

نظام SpyTag / SpyCatcher هو أداة اقتران البروتين الملائمة لربط الببتيد بالبروتين الذي لا رجعة فيه. إنه مثالي للربط ووضع العلامات والتثبيت وإنشاء أنواع جديدة من هياكل البروتين.

  • تشكل SpyTag رابطة أميد عفوية عند ربط شريكها المشفر جينيا SpyCatcher
  • متوافق للغاية - يتفاعل SpyTag مع SpyCatcher في نطاق واسع من الظروف
  • منتج تفاعل مستقر للغاية - مجمع SpyCatcher / SpyTag مستقر للغليان في SDS
  • يحتوي إصدار SpyCatcher (S49C) على بقايا سيستين فريدة لوضع العلامات عليها بدقة باستخدام الصبغة أو التثبيت الدقيق للأسطح أو الخرز

عادة ما يكون تفاعل الببتيد مع البروتينات ضعيفًا. SpyTag هو ببتيد مشفر وراثيًا (تسلسل SpyTag003 RGVPHIVMVDAYKRYK) يشكل رابطة أميد عفوية عند ربط شريكه المشفر وراثيًا SpyCatcher (مع أحدث إصدار SpyCatcher003 متاح هنا). يتفاعل SpyTag003 مع SpyCatcher003 في نطاق واسع من الظروف وبعد التفاعل يكون المنتج مستقرًا للغليان في SDS. يحتوي SpyCatcher003 (S49C) على سيستين فريد لوضع العلامات الدقيقة باستخدام الصبغة أو التثبيت الدقيق للأسطح أو الخرز.

من مختبر مارك هوارث ، دكتوراه ، جامعة أكسفورد.

نوع المنتج: بروتين اسم: كواشف اقتران البروتين SpyTag / SpyCatcher معرف الانضمام: JQ478411.1 (SpyCatcher) مصدر: التعبير المؤتلف في الإشريكية القولونية الوزن الجزيئي الغرامي: 15،597.7 Da (SpyCatcher003) 15،613.7 Da (SpyCatcher003، S49C) 44،867.78 Da (SpyTag003-MBP) تسلسل الأحماض الأمينية: SpyCatcher003: SYYHHHHHHDYDIPTENLYFQGAMVTTLSGLSGEQGPSGDMTTEEDSATHIKFSKRDEDGRELAGATMELRDSSGKTISTWISDGHVKDFYLYPGKYTFVETAAPDGYEVATPIEFTVNEDGQVTTVSpyCatcher003 (S49C): SYYHHHHHHDYDIPTENLYFQGAMVTTLSGLSGEQGPSGDMTTEEDSATHIKFSKRDEDGRELAGATMELRDCSGKTISTWISDGHVKDFYLYPGKYTFVETAAPDGYEVATPIEFTVNEDGQVTVTVSpyTag003: GSSHHHHHHSSGLVPRGSRGVPHIVMVDAYKRYKGSGESGKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS علامة (علامات) الانصهار: N-terminal 6xHis لكل منها نقاء: & GT95٪. تمت تنقيته من كروماتوغرافيا تقارب Ni-NTA ثم كروماتوغرافيا استبعاد الحجم. متعادل: محلول ملحي بالفوسفات (PBS) درجة الحموضة 7.4 تركيز: 2.32 مجم / مل (SpyCatcher003) ، 2.38 مجم / مل (SpyCatcher003 ، S49C) ، 2.47 مجم / مل (SpyTag003-MBP) كمية: 0.5 ملغ تخزين: -80 درجة مئوية ، تجنب دورات التجميد والذوبان المتعددة شحنها: ثلج جاف

يتفاعل SpyCatcher003 مع SpyTag في نطاق الأس الهيدروجيني 5-8 وهو غير حساس نسبيًا لتكوين المخزن المؤقت ، طالما لم يتم استخدام SDS أو العوامل المفسدة مثل اليوريا أو الجوانيدينيوم.

SpyCatcher003: تُظهر SDS-PAGE نطاقًا أعلى من تكوين الجلوكوني ، والذي لا يؤثر على التفاعل مع SpyTag.

  • PI النظرية: 4.52
  • معامل الانقراض عند 280 نانومتر (تنبأ به ProtParam): 17420 م -1 سم -1

SpyCatcher003 (S49C): يُظهر SDS-PAGE نطاقًا ثانيًا عند ميغاواط أعلى قليلاً متعلق بالجلوكوزيل ، لكن هذا لا يؤثر على التفاعل. كما هو متوقع بالنسبة للسيستين المكشوفة ، سيشكل SpyCatcher003 (S49C) في النهاية ثاني كبريتيد عند التخزين. لن يكون هذا النموذج المرتبط بثنائي الكبريتيد متفاعلًا مع المايليميد أو الكواشف الأخرى المتفاعلة مع الثيول. لاختبار مدى تكوين رابطة ثاني كبريتيد ، قم بإجراء SDS-PAGE مع تلطيخ كوماسي مع وبدون DTT.

  • PI النظرية: 4.52
  • معامل الانقراض عند 280 نانومتر (تنبأ به ProtParam): 17420 م -1 سم -1

SpyTag003-MBP:

  • PI النظرية: 5.87
  • معامل الانقراض عند 280 نانومتر (تنبأ به ProtParam): 69330 م -1 سم -1
  1. Keeble AH ، Turkki P ، Stokes S ، Khairil Anuar INA ، Rahikainen R ، Hytönen VP ، Howarth M. الاقتراب من التقارب اللانهائي من خلال هندسة تفاعل البروتين الببتيد. Proc Natl Acad Sci U S A. 2019 ديسمبر 10116 (52): 26523-26533.
  2. Zakeri B ، Fierer JO ، Celik E ، Chittock EC ، Schwarz-Linek U ، Moy VT ، Howarth M. علامة الببتيد تشكل رابطة تساهمية سريعة للبروتين ، من خلال هندسة الالتصاق البكتيري. Proc Natl Acad Sci U S A. 2012 مارس 20109 (12): E690-7.
  3. Veggiani G. ، Zakeri B. ، Howarth M. Superglue من البكتيريا: جسور غير قابلة للكسر لتقنية نانو البروتين. الاتجاهات في التكنولوجيا الحيوية 2014 أكتوبر 32 (10): 506-12.
  4. Schoene C ، Fierer JO ، Bennett SP ، Howarth M. SpyTag / SpyCatcher Cyclization تمنح المرونة للغليان على إنزيم Mesophilic. أنجواندت كيمي. 2014 يونيو 1053 (24): 6101-4.
  5. Fierer JO ، Veggiani G ، Howarth M. SpyLigase ربط الببتيد الببتيد بلمرة الأجسام الفرعية لتعزيز التقاط الخلايا السرطانية المغناطيسية. Proc Natl Acad Sci U S A. 2014 أبريل 1111 (13): E1176-81.
  6. Li L و Fierer JO و Rapoport TA و Howarth M. التحليل الإنشائي وتحسين الارتباط التساهمي بين SpyCatcher وعلامة الببتيد. مجلة البيولوجيا الجزيئية. 2014 يناير 23426 (2): 309-17.
  7. Min ، Duyoung Arbing ، Mark A Jefferson ، Robert E Bowie ، James U. طريقة بسيطة لربط مقبض الحمض النووي لتجارب التلاعب الميكانيكي لجزيء واحد. 2016 0125 (8): 1535-44مشاهدة المقال
  8. Dovala ، Dustin Sawyer ، William S Rath ، Christopher M Metzger ، Louis E. تحليل سريع لتعبير البروتين وقابلية الذوبان باستخدام نظام SpyTag-SpyCatcher. بروتين Expr Purif. 2016 01117: 44-51مشاهدة المقال
  9. ألفيس ، ناثان جي تيرنر ، كندريك بي دانييل ، مايكل إيه أوه ، أونكيو ميدينتز ، إيغور إل والبر ، سكوت إيه ، المفاعلات الحيوية النانوية البكتيرية - توجيه تغليف الإنزيم إلى حويصلات الغشاء الخارجي البكتيرية. واجهات ACS Appl Mater. 2015 11117 (44): 24963-72مشاهدة المقال
  10. ريدينجتون ، صموئيل سي هوارث ، مارك. أسرار التفاعل التساهمي للمواد الحيوية والتكنولوجيا الحيوية: SpyTag و SpyCatcher.Curr Opin Chem Biol. 2015 1229: 94-9مشاهدة المقال
  11. جانيتزيك ، كريستوف إم ماتوندو ، سونغوا ثرين ، سوزان نيلسن ، مورتن إيه كافيش ، ريجينالد مواكالينجا ، ستيف بي ثياندر ، ثور جي سالانتي ، علي ساندر ، آدم إف. استجابات الأجسام المضادة عالية ودائمة. Malar J. 2016 11 0815 (1): 545مشاهدة المقال
  12. سي ، منغ شو ، تشينغ جيانغ ، لينغ هوانغ ، هي. يعزز SpyTag / SpyCatcher Cyclization من قابلية Firefly Luciferase. PLoS One. 201611 (9): e0162318مشاهدة المقال
  13. Zhang، Wen-Bin Sun، Fei Tirrell، David A Arnold، Frances H. التحكم في طوبولوجيا الجزيئات الكبيرة باستخدام كيمياء SpyTag-SpyCatcher المشفرة وراثيًا. J Am Chem Soc. 2013 09 18135 (37): 13988-97مشاهدة المقال
  14. Fairhead، Michael Veggiani، Gianluca Lever، Melissa Yan، Jun Mesner، Dejan Robinson، Carol V Dushek، Omer Van der Merwe، P Anton Howarth، Mark. تتيح محاور SpyAvidin تجميع نانوي متعامد دقيق ومستقر للغاية. 2014 09 03136 (35): 12355-63مشاهدة المقال
  15. تان ، لي لينغ هون ، شون إس وونغ ، فونغ تي. 201611 (10): e0165074مشاهدة المقال
  16. وانغ ، جيندان وانغ ، يلين وانغ ، شينجي زانغ ، داندان وو ، شويو تشانغ ، جوانجيا. استقرار حراري مُحسَّن لـ lichenase من Bacillus subtilis 168 بواسطة SpyTag / SpyCatcher العفوي بوساطة cyclization. Biotechnol Biofuels. 20169: 79مشاهدة المقال
  17. ثرين ، سوزان جانيتزيك ، كريستوف إم ماتوندو ، سونغوا ريسيندي ، مافالدا جوستافسون ، توبياس دي جونغ ، وليم أدريان كليمينسن ، ستاين روفين ، ويل فان دي فيجتي بولمر ، مارغا فان جيميرت ، جيرت جان سوروين ، روبرت شيلر ، جون تي نيلسن ، مورتن أ ثياندر ، ثور جي سالانتي ، علي ساندر ، آدم ف. الغراء الفائق البكتيري يتيح سهولة تطوير لقاحات فعالة شبيهة بالفيروسات تعتمد على الجسيمات. 2016 04 2714: 30مشاهدة المقال
  18. بيدبروك ، كلير إن كاتو ، ميهوكو رافيندرا كومار ، سريبريا لاكشمانان ، أنوباما ناث ، رافي دي صن ، فاي ستيرنبرغ ، بول دبليو أرنولد ، فرانسيس إتش جرادينارو ، فيفيانا. نظام انصهار الببتيد التجسسى المشفر وراثيا للكشف عن البروتينات الموضعية بأغشية البلازما فى الجسم الحي. 2015 08 2022 (8): 1108-21مشاهدة المقال
  19. Sun، Fei Zhang، Wen-Bin Mahdavi، Alborz Arnold، Frances H Tirrell، David A. توليف هيدروجيل البروتين النشط بيولوجيًا بواسطة الكيمياء SpyTag-SpyCatcher المشفرة جينيًا Proc Natl Acad Sci U S A. 2014 08 05111 (31): 11269-74مشاهدة المقال
  20. برون ، كارل دي لينغان ، دارين بريان ، إيونا جي إيشيزوكا ، أندرو إس باكمان ، مارتن إف درابر ، سيمون جي بيسواس ، سومي هوارث ، مارك. التوصيل والعرض: زخرفة الجسيمات الشبيهة بالفيروسات عبر روابط الأيزوببتيد للتمنيع المعياري. Sci Rep. 2016 01 196: 19234مشاهدة المقال
  21. فيجياني ، جيانلوكا ناكامورا ، توموهيكو برينر ، مايكل دي جاييت ، رافائيل في يان ، جون روبنسون ، كارول الخامس هوارث ، مارك. تم تصميم الحزم المتعددة القابلة للبرمجة باستخدام الغراء الفائق الببتيد المزدوج .Proc Natl Acad Sci U S A. 2016 02 02113 (5): 1202-7مشاهدة المقال
  22. شوين ، كريستوفر بينيت ، بول هوارث ، مارك. استجواب SpyRing: تحليل كيف يمكن تحقيق مرونة الإنزيم باستخدام كيمياء إنزيم الفايتيز والكيمياء المتميزة.مشاهدة المقال
  23. برون ، كارل بولدون ، كان لي ، يوانوان تايلور ، إيونا برود ، فلوريان بيسواس ، سومي هوارث ، مارك. تجميع تركيبي مزدوج للتوصيل والعرض باستخدام بروتينات تفاعلية متعامدة لتحصين المستضد المزدوج. 2017 04 24مشاهدة المقال
  24. جاو ، شياويي فانغ ، جي شيويه ، بين فو ، لينجلان لي ، هونغ بين. هيدروجيلات البروتين الهندسية باستخدام كيمياء SpyCatcher-SpyTag. 2016 09 1217 (9): 2812-9مشاهدة المقال
  25. شوين ، سي بينيت ، إس بي هوارث ، إم. 2016580: 149-67مشاهدة المقال
  26. Botyanszki ، و Zsofia Tay ، و Pei Kun R Nguyen ، و Peter Q Nussbaumer ، و Martin G Joshi ، و Neel S. الأغشية الحيوية التحفيزية المُهندَسة: تثبيت إنزيم خاص بالموقع على الألياف النانوية E. coli curli. Biotechnol Bioeng. 2015 10112 (10): 2016-24مشاهدة المقال
  27. ليو ، زيدا زو ، هانغ وانغ ، وينجون تان ، وينجي فو ، يانغ شين تشو ، مينجزاو. طريقة جديدة لبناء لقاح اصطناعي على أساس تجميع البروتين. Sci Rep. 2014 12 014: 7266مشاهدة المقال
  28. Pröschel ، Marlene Detsch ، Rainer Boccaccini ، Aldo R Sonnewald ، Uwe. هندسة المسارات الأيضية عن طريق قنوات الإنزيم الاصطناعي. أمام التكنولوجيا الحيوية الحيوية. 20153: 168مشاهدة المقال
  29. سيغموند ، فانيسا بياتر ، بيرجيت زاكري ، بيجان إيشهورن ، توماس فيشر ، فرانك دويتش ، كارل بيكر ، ستيفان توليكيس ، لارس هوك ، بيورن بيتز ، أولريش كولمار ، هارالد. تكوين رابطة الإيزوببتيد العفوي كأداة قوية لمقترن الأجسام المضادة والأدوية الخاصة بالموقع.مشاهدة المقال
  30. وانغ ، هيجيا هنري ألتون ، بورسين نوي ، كيدو تسوركاس ، أندرو. الربط بوساطة الفرز القائم على القرب. 2017 05 0256 (19): 5349-5352مشاهدة المقال
  31. Alves، Nathan J Turner، Kendrick B Medintz، Igor L Walper، Scott A. حماية الوظيفة الأنزيمية من خلال التغليف الموجه إلى حويصلات الغشاء الخارجي البكتيرية. Sci Rep. 2016 04276: 24866مشاهدة المقال
  32. Chen ، Allen Y Deng ، Zhengtao Billings ، Amanda N Seker ، Urartu O S Lu ، Michelle Y Citorik ، Robert J Zakeri ، Bijan Lu ، Timothy K. 2014 0513 (5): 515-23مشاهدة المقال
  33. ريجان ، لين كاباليرو ، دييجو هينريكسن ، مايكل آر فيرويتا ، أليخاندرو ويليامز ، دانييل إم أوهيرن ، كوري إس.تصميم البروتين: الماضي والحاضر والمستقبل. 2015 07104 (4): 334-50مشاهدة المقال
  34. ليونارد ، جون دي نارليكار ، جيتا جيه. مفتاح يحركه النوكليوتيدات ينظم استشعار طول الحمض النووي المحيط بواسطة جهاز إعادة تشكيل الكروماتين ثنائي الأبعاد. 2015 03 0557 (5): 850-9مشاهدة المقال
  35. Liu، Xueliang Lopez، Paola A Giessen، Tobias W Giles، Michael Way، Jeffrey C Silver، Pamela A. الهندسة المعدنية المشفرة وراثيًا والمغناطيسية عبر Directed Evolution.Sci Rep. 2016 11 296: 38019مشاهدة المقال
  36. شميد بورغ ، جوناثان إل هونينغ ، كلارا إيبرت ، توماس إس هورنونغ ، فيت. يسمح CRISPaint بوضع علامات على الجينات المعيارية الخاصة بالقاعدة باستخدام آلية تعتمد على ligase-4. 2016 07287: 12338مشاهدة المقال
  37. زاكري ، بيجان لو ، تيموثي ك. البيولوجيا التركيبية لاكتشاف مضادات الميكروبات. ACS Synth Biol. 2013 07192 (7): 358-72مشاهدة المقال
  38. عالم MK ، السيد A ، Barreto K ، Bernhard W ، Fonge H ، Geyer CR. وضع العلامات الفلورية الخاصة بالموقع للأجسام المضادة والأجسام باستخدام نظام SpyTag / SpyCatcher للتصوير البصري في الجسم الحي. مول التصوير بيول. 2018 12 يونيو. مشاهدة المقال

إذا نشرت بحثًا عن هذا المنتج ، فيرجى إخبارنا حتى نتمكن من الاستشهاد بمقالك.


الملخص

التحقيق في العمليات البيولوجية المعقدة في الجسم الحي غالبًا ما يتطلب اقترانًا حيويًا متعددًا محددًا وتحديد مواقع الكيانات الوظيفية على الهياكل ثلاثية الأبعاد. تشمل الأمثلة البارزة مجمعات البروتين المحددة مكانيًا في الطبيعة ، مما يسهل التحفيز الحيوي الفعال للتفاعلات متعددة الخطوات. تقليدًا للاستراتيجيات الطبيعية ، يجب أن تشتمل السقالات الاصطناعية على تفاعلات اقتران متعامد بيولوجيًا وتسمح بالتقدير الكمي المتكافئ المطلق بالإضافة إلى قابلية التوسع السهلة من خلال إعادة إنتاج السقالة. موجود في الجسم الحي غالبًا ما تفتقر استراتيجيات السقالات إلى الاقتران التساهمي على السقالات المحصورة هندسيًا أو التوصيف الكمي الدقيق. لمعالجة أوجه القصور هذه ، نقدم منصة اقتران ثنائي متعامد بيولوجيًا تعتمد على مقصورات اصطناعية مشفرة وراثيًا في الجسم الحي ، يتألف من اثنين من تفاعلات الاقتران التساهمي المشفر وراثيا وتقديرها الدقيق المتكافئ. تم تنفيذ الاقتران الحيوي SpyTag / SpyCatcher (ST / SC) و cycloaddition الذي يمكن التحكم فيه بواسطة azide − alkyne cycloaddition (SPAAC) على مقصورات قائمة على غشاء البروتين المجمعة ذاتيًا (PMBCs). تم قياس إنتاجية تفاعل SPAAC لتكون 23٪ ± 3٪ ولوحظ عائد اقتران سطح ST / SC بنسبة 82٪ ± 9٪ ، مع التحقق من توافق كل من التفاعلات الكيميائية بالإضافة إلى استقرار التحلل البروتيني المعزز.باستخدام مقياس الطيف الكتلي الترادفي ، تم حساب التركيزات المطلقة للمتفاعلات البروتينية لتكون 0.11 ± 0.05 أتومول / خلية لـ PMBC المربوطة بالسطح mCherry-ST-His و 0.22 ± 0.09 أتومول / خلية لـ PMBC المكونة لـ pAzF-SC-E20F20-His. المنشأة في الجسم الحي تتيح منصة الاقتران دراسات تفاعل البروتين والبروتين القابلة للقياس الكمي على السقالات المحددة هندسيًا وتمهد الطريق لاستكشاف آثار ربط السقالات على نشاط الإنزيم.


المواد والأساليب

استنساخ

تم استنساخ بلازميدات التعبير باستخدام طرق PCR القياسية وتجميع جيبسون [27]. لإنشاء بلازميدات pFUSEss-CHIg-Nimotuzumab-hG1-SpyTag و pFUSEss-CHIg-MBP-hG1-SpyTag ، قدمنا ​​أولاً SpyTag في pFUSEss-CHIg-hG1 بلازميد (Invivogen) عند الطرف C من مجال FUSc -CHIg-hG1-SpyTag البلازميد. تم بعد ذلك تقديم نيموتوزوماب ونطاقات VH المضادة لـ MBP في الطرف N من CH1 من بلازميد pFUSEss-CHIg-hG1-SpyTag لإنشاء pFUSEss-CHIg-Nimotuzumab-hG1-SpyTag (انظر المواد التكميلية الإلكترونية (ESM): SEQ: 01 ) و pFUSEss-CHIg-Anti-MBP-hG1-SpyTag (انظر ESM SEQ: 02) البلازميدات ، على التوالي. لتوليد pFUSEss-CLIg-Nimotuzumab-hG1 و pFUSEss-CLIg-Anti-MBP-hG1 البلازميدات ، تم تقديم nimotuzumab ومجال VL المضاد لـ MBP في الطرف N من CL لبلازميد pFUSEss-CLIg-hG1-hk (Invivogen) ، على التوالى.

استخدمنا pCW-SpyCatcher-His المبلغ عنه سابقًا6 [17] لاستنساخ الجسم المضاد لـ HER3 و anti-MBP. لتوليد pCW-anti-HER3-diabody-SpyCatcher-His6 (راجع ESM SEQ: 03) و pCW-anti-MBP-diabody-SpyCatcher-His6 (انظر ESM SEQ: 04) ، تم تضخيم البلازميدات ، والجسم المضاد لـ HER3 والجسم المضاد لـ MBP ، PCR من البلازميدات pCW-anti-HER3-Fab و pCW-anti-MBP-Fab [28] ، على التوالي ، باستخدام تمديد التداخل بادئات TGS157 و KA3R [17]. تم استنساخ منتج PCR إلى Sac1 / Xho1-هضم pCW-SpyCatcher-His6 البلازميد باستخدام تجميع جيبسون.

التعبير عن الأجسام المضادة وتنقيتها

تم التعبير عن Nimotuzumab-SpyTag و anti-MBP-SpyTag باستخدام نظام التعبير Gibco ™ Expi293 ™ (تقنيات الحياة ، رقم الكتالوج A14635) ، وفقًا لبروتوكول الشركة المصنعة. باختصار ، قبل يوم واحد من ترنسفكأيشن ، تم تخفيف خلايا Expi293F إلى 2 × 10 6 خلايا / مل في Expi293 Expression Medium (تقنيات الحياة). في يوم ترنسفكأيشن ، تم تجميع 30 ميكروغرام من DNA البلازميد (نسبة 1: 1) مع 80 ميكرولتر من كاشف ExpiFectamine ™ 293. تم بعد ذلك نقل الحمض النووي المعقد إلى 7.5 × 10 7 خلايا (كثافة الخلية النهائية 2.5 × 10 6 خلية / مل). في اليوم التالي ، تمت إضافة المعززات 1 و 2 إلى الوسائط لرفع الحجم النهائي إلى 30 مل. تم زرع الخلايا لمدة 6-7 أيام. تم نسج الخلايا ، وتم جمع المادة الطافية وتصفيتها من خلال مرشح غشاء 0.45 ميكرومتر (Minisart ، Sartorius Stedim). تمت إضافة محلول ربط البروتين A (فوسفات الصوديوم 20 ملي مولار ، 0.15 مولار كلوريد الصوديوم ، الرقم الهيدروجيني 7.2) إلى المادة الطافية ، وتمت تنقية الجسم المضاد - SpyTag بواسطة نظام GE Healthcare AKTA FPLC باستخدام عمود HiTrap MabSelect (GE Healthcare). تمت إزالة الأجسام المضادة SpyTag باستخدام محلول شطف IgG (Fisher Scientific) وتم تحييده باستخدام محلول التعادل (1 M Tris-HCl pH 9.0). تم غسيل الجسم المضاد - SpyTag طوال الليل بمحلول ملحي مخزّن من الفوسفات (PBS) وتركيزه باستخدام مرشح 30 K MWCO (Millipore). تم تعقيم شظايا المرشح وتخزينها عند - 80 درجة مئوية.

التعبير وتنقية انصهار Diabody-SpyCatcher

مضاد لـ HER3 ديابودي-سباي كاتشر ومضاد لـ MBP ديابودي-سبايكاتشر بلازميدات لها تسلسل pelB للتوسط في إفرازها في الفضاء المحيط بالبلازما بكتريا قولونية. تم إمداد البلازميدات بالكهرباء في Rosetta (DE3) المختصة بكتريا قولونية الخلايا (Novagen) والمزروعة على ألواح أجار LB التي تحتوي على الكاربينيسيليان (100 ميكروغرام / م) والكلورامفينيكول (34 ميكروغرام / مل). تم انتقاء مستعمرات مفردة واستزراعها طوال الليل في وسائط السل الفوري (Novagen) لمدة 20 ساعة عند 30 درجة مئوية مع الرج (250 دورة في الدقيقة). تمت تنقية اندماج Diabody-SpyCatcher باستخدام نظام AKTA FPLC (GE Healthcare) باستخدام عمود HiTrap Protein L (GE Healthcare) كما هو موضح سابقًا [17]. باختصار ، تم جمع بيليه الخلية عن طريق الطرد المركزي وإعادة تعليقها في محلول ربط البروتين L (فوسفات الصوديوم 20 ملي مولار ، 0.15 مولار كلوريد الصوديوم ، درجة الحموضة 8.0). تم تفكيك الحبيبات الخلوية باستخدام معطل الخلية (Constant System LTD. USA) الذي تم ضبطه عند 35 Kpsi. تم طرد محلول تحلل الخلية عند 12000 ×ز لمدة 20 دقيقة. تم جمع المادة الطافية وتصفيتها من خلال مرشح غشاء 0.45 ميكرومتر (Minisart ، Sartorius Stedim) وتحميلها على عمود HiTrap Protein L باستخدام نظام Akta Prime (GE Healthcare). تمت إزالة الأجسام السكرية باستخدام محلول شطف IgG (Fisher Scientific) وتم تحييده باستخدام محلول معادل (1 M Tris-HCl pH 9.0). تم غسيل الأجسام الثنائية المنقاة طوال الليل في PBS وتركيزها باستخدام مرشح 10 K MWCO. تم تعقيم أجسام السكري وتخزينها عند درجة حرارة 80 درجة مئوية.

وضع العلامات IRDye800CW على SpyTag و SpyCatcher

تم شراء الببتيد SpyTag (AHIVMVDAYKPTK) من Genescript. تم استخدام إستر IRDye800CW-NHS (LI-COR Biosciences Co. ، Lincoln ، NE) لتسمية SpyTag. تم تمييز 1 مجم من SpyTag في محلول ملحي مخزَّن بالفوسفات سعة 1 مل (PBS ، الرقم الهيدروجيني 7.4) مع زيادة ضرس 3 أضعاف من IRDye800CW-NHS عن طريق تدوير الخليط ببطء لمدة ساعتين عند درجة حرارة الغرفة المحمية من الضوء متبوعًا بالتناوب طوال الليل عند 4 درجات ج. تم إخماد التفاعل مع زيادة مولارية بمقدار 1 مولار تريس. تم تخزين SpyTag المسمى عند - 20 درجة مئوية.

تم شراء SpyCatcher مع السيستين عند الطرف N من Kerafast (# EOX004). IRDye800CW-Maleimide (LI-COR Biosciences Co. ، Lincoln ، NE ، الولايات المتحدة الأمريكية) وتستخدم لتسمية cysteine-SpyCatcher. تم تقليل SpyCatcher (1 مجم) في محلول ملحي مخزَّن بالفوسفات سعة 1 مل (PBS ، الرقم الهيدروجيني 7.4) عن طريق إضافة 70 ضعفًا زائدًا من المولي من Tris (2-Carboxyethyl) Phosphine hydrochloride (TCEP) واحتضانه طوال الليل عند 4 درجات مئوية مع الاهتزاز. تمت إزالة TCEP الزائد باستخدام أعمدة Zeba Spin Desalting ، 7 K MWCO (Thermo Scientific ، رقم الكتالوج 89892). تم تمييز SpyCatcher المخفّض ب 10 أضعاف المولي الزائد من IRDye800CW - مالييميد بالتناوب لمدة ساعتين في درجة حرارة الغرفة المحمية من الضوء متبوعًا بالتناوب طوال الليل عند 4 درجات مئوية. تمت إزالة الصبغة الزائدة عن طريق تمرير المحلول خلال 5 مل من أعمدة إزالة الأملاح Zeba Spin ، 7 K MWCO. تم تخزين SpyCatcher المسمى عند - 80 درجة مئوية.

ربط الأجسام المضادة - SpyTag مع SpyCatcher-IRDye800CW و Diabody-Catcher مع SpyTag-IRDye800CW

تم ربط Nimotuzumab-SpyTag و Anti-MBP-SpyTag (10 ميكرومتر) بـ SpyCatcher-IRDye800CW (30 ميكرومتر) لمدة 3 ساعات عند درجة حرارة الغرفة في وجود محلول فوسفات سيترات ، درجة الحموضة 7 ، كما وصفها Alam et al. [17] وزاكري وآخرون. [15]. تمت تسمية المنتجات المرتبطة لتعكس اتجاه SpyTag و SpyCatcher. على سبيل المثال ، تم تصنيف الأجسام المضادة - SpyCatcher التي تفاعلت مع SpyTag-IRDye800CW بالجسم المضاد-SpyCatcher / SpyTag-IRDy800CW. تمت تنقية Nimotuzumab-SpyTag / SpyCatcher-IRDye800CW ومضاد MBP-SpyTag / SpyCatcher -IRDye800CW باستخدام كروماتوجرافيا البروتين A لإزالة SpyCatcher-IRDye800CW. تم ربط Anti-HER3 Diabody-SpyCatcher والجهاز SpyCatcher المضاد لـ MBP (10 ميكرومتر) بـ SpyTag-IRDye800CW (30 ميكرومتر) باستخدام نفس البروتوكول الموصوف سابقًا [17]. تمت تصفية منتجات Diabody-SpyCatcher / SpyTag-IRDye800CW من خلال مُكثّف 10 كيلو دالتون MWCO (ميليبور). تم تكرار الترشيح أربع مرات باستخدام برنامج تلفزيوني لإزالة SpyTag-IRDye800CW غير المرتبط.

تم تعقيم Antibody-SpyTag / SpyCatcher-IRDye800CW و diabody-SpyCatcher / SpyTag-IRDye800CW باستخدام مرشح Millipore Ultrafree MC. تم قياس التركيز باستخدام الصيغة: Protein Conc (mg / ml) = (A280- (0.030A780)) / البروتين × MW البروتين × عامل التخفيف. 0.03 هو عامل تصحيح لامتصاص IRDye800CW عند 280 نانومتر (يساوي 3.0٪ من امتصاصه عند 780 نانومتر). εبروتين هو معامل الانقراض المولي للبروتين. ميغاواطبروتين هو الوزن الجزيئي للبروتين. عامل التخفيف هو تخفيف البروتين المسمى قبل القياس بواسطة مقياس الطيف الضوئي. تم حساب عدد جزيئات IRDye800CW على الجسم المضاد أو الجسم باستخدام الصيغة التالية: IRDye800CW / protein = (أ789/ εIR)/(أ280 – (0.03 × أ778) / εبروتين) حيث ɛIR هو معامل الانقراض المولي لـ IRDye800CW و ɛبروتين هي معاملات الانقراض المولي للجسم المضاد أو الجسم السكري.

تحليل SDS-PAGE

تم حل الأجسام المضادة والأجسام الثنائية التي تم تنقيتها بواسطة IRDye800CW تحت ظروف مختزلة أو غير مختزلة باستخدام هلام BioRad مسبق الصب بنسبة 4-15٪ (BioRad ، رقم الكتالوج 56-1084) باستخدام خلية BioRad PowerPac ™. كانت المواد الهلامية ملطخة باللون الأزرق كوماسي. بعد التدمير ، تم تصور عصابات البروتين بواسطة نظام BioRad GelDoc XR +. تم فحص المواد الهلامية SDS-PAGE غير الملوثة باستخدام نظام Odyssey Infrared Imaging (LI-COR Bioscience) ومعالجة الصور باستخدام برنامج تطبيق Odyssey 3.0.16 (LI-COR Bioscience).

التحليل المعتمد على الرحلان الكهربائي على جهاز التحليل الحيوي Agilent 2100

تم قياس الوزن الجزيئي (MW) ونقاء الأجسام المضادة والأجسام الثنائية باستخدام مجموعة البروتين عالي الحساسية 250 (Agilent ، رقم الكتالوج 5067-1575) ، وفقًا لبروتوكول الشركة المصنعة. باختصار ، تم تصنيف الأجسام المضادة والأجسام السكري (1 مجم / مل) باستخدام صبغة الفلورسنت وتحليلها باستخدام نظام 2100 Bioanalyzer (Agilent). تم حساب الوزن الجزيئي ومناطق الذروة باستخدام برنامج 2100 Expert (Agilent).

قياس التداخل البيولوجي

تم إجراء التحليلات الحركية باستخدام أداة ForteBio OctetRed 384 ، وفقًا لبروتوكولات الشركة المصنعة. تم تجميد تركيبات SpyCatcher / SpyTag Nimotuzumab إلى مستشعرات التقاط IgG Fc المضادة للإنسان (ForteBio) وتم قياس تفاعلها مع تحليل hEGFR المؤتلف (نظام R & ampD). بالنسبة لجهاز SpyCatcher / SpyTag المضاد لـ HER3 ، تم تجميد Fc-hHER3 المؤتلف (نظام R & ampD) إلى مستشعرات IgG Fc-capture المضادة للإنسان (ForteBio) ، وتم قياس تفاعلها مع تحليل الجسم السكري. تم تجميد الجسم المضاد لـ HER3 غير المصنف إلى مستشعرات الجيل 2 التفاعلي للأمين (ARG2) (ForteBio) ، وتم قياس تفاعله مع تحليل Fc-hHER3 المؤتلف (نظام R & ampD). تم تجميد الأجسام المضادة والشظايا في المستشعرات عن طريق غمس المستشعر في لوح قاع مائل جيدًا 384 ، يحتوي على 50 ميكرولتر من 10-12 ميكروغرام / مل من الجسم المضاد أو جزء. معدلات الارتباط (كتشغيل) لمدة 2-5 دقائق ، ومعدلات التفكك (كإيقاف) لمدة 10 دقائق. تم إجراء تفاعلات ملزمة عند 30 درجة مئوية في برنامج تلفزيوني. تم جمع البيانات باستخدام إصدار Octet Data Acquisition 8.1 (ForteBio) وتناسب بشكل عام مع نموذج الربط 1: 1 باستخدام Octet Data Analysis الإصدار 7.1 (ForteBio).

خطوط الخلية

تم الحصول على خط الخلايا السرطانية الحرشفية البشرية A431 الذي يعبر عن EGFR من ATCC (Rockville ، MD ، الولايات المتحدة الأمريكية). تم الحصول على سرطان الخلايا الحرشفية في الرأس والرقبة من خط خلايا FaDu الذي يفرط في التعبير عن HER3 من ATCC (Rockville ، MD ، الولايات المتحدة الأمريكية). تم نشر الخلايا عن طريق المرور التسلسلي في وسط RPMI و MEM / EBSS ، على التوالي ، مكملًا بنسبة 10 ٪ من مصل بقري جنيني (Biochrom) عند 37 درجة مئوية في جو رطب بنسبة 5 ٪ CO.2.

التدفق الخلوي

تم تحديد ارتباط الأجسام المضادة - SpyTag / SpyCatcher-IRDye800CW بخلايا A431 والجسم الثنائي - SpyCatcher / SpyTag-IRDye800CW بخلايا FaDu باستخدام قياس التدفق الخلوي. لتحليل التدفق الخلوي ، تم تحضين 2 × 10 5 خلية / أنبوب مع 50 ميكرولتر من الأجسام المضادة أو الأجسام المضادة التي تحمل علامة IRDye800CW في درجة حرارة الغرفة ، محمية من الضوء ، لمدة 60 دقيقة ، تليها ثلاث عمليات غسل باستخدام PBS ، ودرجة الحموضة 7.4. تمت مراقبة انبعاث الخلايا الفلورية باستخدام مقياس تدفق جاليوس (Beckman Coulter ، Inc.) عند إثارة 640 نانومتر مع مرشح الانبعاث الذي تم إعداده عند 745-825 نانومتر. تم تحليل بيانات التدفق الخلوي باستخدام Kaluza (Beckman Coulter ، Inc.).

في فيفو تصوير الحيوانات

تم رعاية الحيوانات المستخدمة في تجارب التصوير وصيانتها تحت إشراف وإرشادات لجنة رعاية الحيوان بجامعة ساسكاتشوان. تم الحصول على إناث الفئران العارية CD-1 من Charles River Canada (St-Constant ، كيبيك ، كندا) في عمر 4 أسابيع وتم وضعها في دورة مظلمة / فاتحة مدتها 12 ساعة في حوض متحكم بدرجة الحرارة والرطوبة. حصلت الحيوانات على حق الوصول إلى النظام الغذائي للفأر (Lab Diet ، سانت لويس ، ميزوري ، الولايات المتحدة الأمريكية) والماء. بعد أسبوع واحد من التأقلم ، تم حقن الفئران تحت الجلد بتعليق 1 × 10 7 A431 خلية أو خلايا FaDu في 100 ميكرولتر من خليط 1: 1 من وسط MEM / EBSS الخالي من المصل (HyClone Laboratories ، Logan ، UT ، USA) والغشاء القاعدي لمصفوفة ماتريجيل (ديسكفري لابوير ، بيدفورد ، ماساتشوستس ، الولايات المتحدة الأمريكية) في الطرف الخلفي لكل فأر. تمت متابعة نمو الورم بقياسات الفرجار الخارجي. تم حساب حجم الورم باستخدام المعادلة التالية: حجم الورم = الطول × العرض 2 × 0.5 [29]. تم حقن الوريد الذيل بمقدار 0.5 نانومول من الأجسام المضادة - SpyTag / SpyCatcher-IRDye800CW لـ A431 xenografts و diabody-SpyCatcher / SpyTag-IRDye800CW لـ FaDu xenografts تم حقنها عن طريق الوريد عند قياس xenografts 150-300 مم 3. تم تخدير الفئران باستخدام 2.5 ٪ من الأيزوفلورين وتم تصويرها في نقاط زمنية مختلفة باستخدام Pearl Impulse Imager (LI-COR) مع إعدادات الإثارة / الانبعاث 785/820 نانومتر. تم تراكب إشارة التألق مع صورة الضوء الأبيض التي تم التقاطها بواسطة كاميرا CCD ، وتم تحليل الصور باستخدام برنامج Image Studio (الإصدار 3.1). تم تحديد مناطق الاهتمام (ROI) للطعام xenografts والكبد والكلى والخلفية من مناطق ذات حجم مكافئ تحتوي على نفس عدد وحدات البكسل. تم تحديد كمية ثلاثة عائد استثمار لكل عضو لكل فأر وتم تصوير ثلاثة فئران لكل جسم مضاد أو جسم ثنائي. عمل الجسم المضاد والأجسام الثنائية المرتفعة ضد MBP كعنصر تحكم غير محدد في تجارب التصوير.


المطالبات

1. تسلسل الحمض النووي المعزول الذي يشفر مستقبلات مناعية عالمية ، حيث يشتمل المستقبل المناعي الشامل إما على SpyCatcher أو SpyTag مجال ربط خارج الخلية مرتبط بمنطقة مفصلة خارج الخلية ، والتي بدورها مرتبطة بمجال عبر الغشاء المرتبط بدوره بـ مجال إشارات مستقبلات الخلايا التائية داخل الخلايا.

2. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 1 ، حيث يرتبط مجال ربط SpyCatcher خارج الخلية بمجال المفصلة خارج الخلية.

3. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 1 ، حيث يرتبط مجال ربط SpyTag خارج الخلية بمجال المفصلة خارج الخلية.

4. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 1 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الحمض النووي المختار من المجموعة التي تتكون من رقم تعريف التسلسل: 1 ، 3 ، 5 ، 7 ، 9 ، 11 ، 13 و 15.

5. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 2 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الحمض النووي المختار من المجموعة التي تتكون من رقم تعريف التسلسل: 5 و 7 و 13 و 15.

6. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 3 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الحمض النووي المختار من المجموعة التي تتكون من رقم تعريف التسلسل: 1 و 3 و 9 و 11.

7. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 1 ، حيث يشتمل مجال الإشارة داخل الخلايا لمستقبل الخلايا التائية أيضًا على جزيء تكلفة.

8. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 1 ، حيث يفتقر مجال الإشارة داخل الخلايا لمستقبل الخلايا التائية إلى قدرة الإشارة إلى حد كبير.

9. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 8 ، حيث يتم اختيار المجال داخل الخلايا للجزيء المسؤول عن التكلفة من المجموعة المكونة من CD27 ، CD28 ، CD2 ، CD3 ، 4-1BB ، OX40 ، CD30 ، CD40 ، PD-1 ، ICOS ، المستضد المرتبط بوظيفة الخلايا الليمفاوية -1 (LFA-1) ، CD7 ، LIGHT ، NKG2C ، B7-H3 ، رابطة مرتبطة بشكل خاص بـ CD83 ، وأي توليفة منها.

10. تسلسل حمض نووي معزول يشفر إما SpyCatcher أو SpyTag مرتبط بجزيء يشتمل على واحد على الأقل مختار من المجموعة المكونة من قليل النوكليوتيد ، جسم مضاد ، جزء من الجسم المضاد ، scFv ، سقالة بروتينية ، ببتيد ، ليجند ، aptamer ، عامل الوسم ، مستضد الورم ، مستضد ذاتي ، مستضد فيروسي ، وأي توليفة منها.

11. تسلسل الحمض النووي المعزول وفقًا لعنصر الحماية 10 ، حيث يتم اختيار عامل الوسم من المجموعة المكونة من myc-tag ، و FLAG-tag ، و His-tag ، و HA-tag ، وبروتين فلوري (مثل بروتين الفلورسنت الأخضر (GFP)) ، فلوروفور (مثل tetramethylrhodamine (TRITC) ، fluorescein isothiocyanate (FITC)) ، ثنائي نتروفينول ، مركب بروتين كلوروفيل بيريدين ، بروتين فلوري أخضر ، Phycoerythrin (PE) ، هيستيدين ، بيوتين ، ستربتافيدين ، أفيدين ، أفيدين ، بيروكسيتين الفجل الفوسفاتاز ، الجلوكوز أوكسيديز ، الجلوتاثيون S-ترانسفيراز (GST) ، بروتين رابط المالتوز ، النظائر المشعة ، وأي نوع من المركبات المستخدمة في وضع العلامات على النظائر المشعة ، بما في ذلك ، 1،4،7،10-tetraazacyclodecane-1،4،7،10-tetraacetic حمض (DOTA) ، حمض ثنائي إيثيلين ثلاثي أمين بنتاسيتيك (DTPA) ، و 1،4،7-تريازاسيكلونونان-1،4،7-حمض ثلاثي أسيتيك (نوتا).

12. مستقبل مناعي عالمي معزول يضم إما SpyCatcher أو SpyTag مجال ربط خارج الخلية مرتبط بمنطقة مفصلية خارج الخلية ، والتي بدورها مرتبطة بمجال عبر الغشاء والذي بدوره مرتبط بمجال إشارات مستقبل الخلايا التائية داخل الخلايا.

13. المستقبل المناعي العالمي المعزول من الإدعاء 12 ، حيث يرتبط مجال ربط SpyCatcher خارج الخلية بمجال المفصلة خارج الخلية.

14. المستقبل المناعي العالمي المعزول من الإدعاء 12 ، حيث يرتبط مجال الربط خارج الخلية SpyTag بمجال المفصلة خارج الخلية.

15. المستقبل المناعي الشامل المعزول وفقًا لعنصر الحماية 12 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الأحماض الأمينية المختارة من المجموعة التي تتكون من رقم تعريف التسلسل: 2 ، 4 ، 6 ، 8 ، 10 ، 12 ، 14 و 16.

16. المستقبل المناعي الشامل المعزول لعنصر الحماية 13 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الأحماض الأمينية المختارة من المجموعة التي تتكون من رقم تعريف التسلسل: 6 و 8 و 14 و 16.

17. المستقبل المناعي الشامل المعزول حسب عنصر الحماية 14 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل الحمض الأميني المختار من المجموعة التي تتكون من رقم تعريف التسلسل: 2 و 4 و 10 و 12.

18. المستقبل المناعي الشامل المعزول وفقًا لعنصر الحماية 12 ، حيث يشتمل مجال إشارات مستقبل الخلايا التائية داخل الخلايا أيضًا على جزيء تكلفة.

19. المستقبل المناعي العالمي المعزول حسب ادعاء 18 ، حيث يتم اختيار المجال داخل الخلايا للجزيء المسؤول عن التكلفة من المجموعة المكونة من CD27 ، CD28 ، CD2 ، CD3 ، 4-1BB ، OX40 ، CD30 ، CD40 ، PD-1 ، ICOS ، مستضد مرتبط بوظيفة الخلايا الليمفاوية -1 (LFA-1) ، CD7 ، LIGHT ، NKG2C ، B7-H3 ، رابطة مرتبطة بشكل خاص بـ CD83 ، وأي توليفة منها.

20. المستقبل المناعي العالمي المعزول وفقًا لعنصر الحماية 12 ، حيث يرتبط المستقبل المناعي العالمي المعزول بتركيبة تشتمل إما على جزيء مرتبط بـ SpyTag أو SpyCatcher.

21- المستقبل المناعي الشامل المعزول وفقاً لعنصر الحماية 20 ، حيث يشتمل الجزيء المرتبط بـ SpyTag أو SpyCatcher على واحد على الأقل يتم اختياره من المجموعة التي تتكون من قليل النوكليوتيد ، جسم مضاد ، جزء من الجسم المضاد ، scFv ، سقالة بروتينية ، ببتيد ، يجند ، aptamer ، عامل وضع العلامات ، مستضد الورم ، مستضد ذاتي ، مستضد فيروسي ، وأي توليفة منها.

22.المستقبل المناعي العالمي المعزول للمطالبة 21 ، حيث يتم اختيار عامل الوسم من المجموعة التي تتكون من myc-tag و FLAG-tag و His-tag و HA-tag وبروتين الفلورسنت (مثل البروتين الفلوري الأخضر (GFP)) ، فلوروفور (مثل رباعي ميثيل رودامين (TRITC) ، فلورسين أيزوثيوسيانات (FITC)) ، دينيتروفينول ، مركب بروتين كلوروفيل بيريدينين ، فيكويريثرين (PE) ، هيستيدين ، بيوتين ، ستربتافيدين ، أفيدين ، فجل الحصان بيروكسيداز ، أكسبيوتازين ، أفيدين S-transferase (GST) ، بروتين رابط المالتوز ، نظائر مشعة ، وأي نوع من المركبات المستخدمة في وضع العلامات على النظائر المشعة ، بما في ذلك ، 1،4،7،10-tetraazacyclodecane-1،4،7،10-tetraacetic acid (DOTA)، diethylene حمض التريامين بنتاسيتيك (DTPA) ، وحمض 1.4.7-triazacyclononane-1،4،7-triacetic acid (NOTA).

23. خلية تشتمل على تسلسل الحمض النووي للتسلسل الذي يشفر مستقبلات مناعية عالمية ، حيث يشتمل المستقبل المناعي الشامل إما على SpyCatcher أو SpyTag مجال ربط خارج الخلية مرتبط بمنطقة مفصلية خارج الخلية ، والتي بدورها مرتبطة بمجال عبر الغشاء يكون يرتبط بدوره بمجال الإشارات داخل الخلايا لمستقبل الخلايا التائية.

24. خلية عنصر الحماية 23 ، حيث يكون مجال الربط خارج الخلية SpyCatcher مرتبطًا بمجال المفصلة خارج الخلية.

25. خلية عنصر الحماية 23 ، حيث يكون مجال ربط SpyTag خارج الخلية مرتبطًا بمجال المفصلة خارج الخلية.

26. الخلية وفقاً لعنصر الحماية 23 ، حيث يتم اختيار الخلية من المجموعة التي تتكون من خلية T ، خلية قاتلة طبيعية (NK) ، خلية ليمفاوية T سامة للخلايا (CTL) ، بلاعم ، خلية جذعية ، وخلية T تنظيمية .

27. الخلية وفقًا لعنصر الحماية 23 ، حيث يتم تنشيط الخلية عندما يرتبط المستقبل المناعي العالمي المعزول المشفر بتركيبة تشتمل إما على جزيء مرتبط بـ SpyTag أو SpyCatcher.

28. الخلية وفقاً لعنصر الحماية 27 ، حيث يشتمل الجزيء المرتبط بـ SpyTag أو SpyCatcher على واحد على الأقل يتم اختياره من المجموعة التي تتكون من قليل النوكليوتيد ، جسم مضاد ، جزء جسم مضاد ، scFv ، سقالة بروتين ، ببتيد ، مستقبل ، يجند ، aptamer ، عامل وضع العلامات ، مستضد الورم ، مستضد ذاتي ، مستضد فيروسي ، وأي توليفة منها.

29. الخلية وفقاً لعنصر الحماية 28 ، حيث يتم اختيار عامل الوسم من المجموعة التي تتكون من myc-tag ، و FLAG-tag ، و His-tag ، و HA-tag ، وبروتين الفلوريسنت (مثل البروتين الفلوري الأخضر (GFP)) ، وفلوروفور (على سبيل المثال ، رباعي ميثيل رودامين (TRITC) ، فلورسين أيزوثيوسيانات (FITC)) ، دينيتروفينول ، مركب بروتين كلوروفيل بيريدينين ، فيكويريثرين (PE) ، هيستيدين ، بيوتين ، ستربتافيدين ، أفيدين ، بيروكسيداز الفجل ، بالميتويلين ، نيتروزيلاز -ترانسفيراز (GST) ، بروتين رابط المالتوز ، نظائر مشعة ، وأي نوع من المركبات المستخدمة في وضع العلامات على النظائر المشعة ، بما في ذلك ، 1،4،7،10-tetraazacyclodecane-1،4،7،10-tetraacetic acid (DOTA) ، داي إيثيلين تريامين حمض البنتاسيتيك (DTPA) ، وحمض 1.4.7-triazacyclononane-1،4،7-triacetic acid (NOTA).

30- ناقل يشتمل على تسلسل حمض نووي يشفر مستقبل مناعي عالمي ، حيث يشتمل المستقبل المناعي الشامل على SpyCatcher أو SpyTag على مجال ربط خارج الخلية مرتبط بمنطقة مفصلية خارج الخلية ، والتي بدورها مرتبطة بمجال عبر الغشاء والذي بدوره مرتبط بمجال الإشارات داخل الخلايا لمستقبل الخلايا التائية.

31. متجه عنصر الحماية 30 ، حيث يرتبط مجال ربط SpyCatcher خارج الخلية بمجال المفصلة خارج الخلية.

32. متجه عنصر الحماية 30 ، حيث يرتبط مجال ربط SpyTag خارج الخلية بمجال المفصلة خارج الخلية.

33. متجه عنصر الحماية 30 ، حيث يمكن للمستقبل المناعي العالمي المعزول المشفر الارتباط بتركيبة تشتمل إما على SpyTag- أو جزيء مرتبط بـ SpyCatcher.

34. متجه عنصر الحماية 33 ، حيث يشتمل الجزيء المرتبط بـ SpyTag أو SpyCatcher على واحد على الأقل يتم اختياره من المجموعة التي تتكون من قليل النوكليوتيد ، جسم مضاد ، جزء جسم مضاد ، scFv ، سقالة بروتين ، ببتيد ، مستقبل ، يجند ، aptamer ، عامل الوسم ، مستضد الورم ، مستضد ذاتي ، مستضد فيروسي ، وأي توليفة منها.

35. متجه الادعاء 34 ، حيث يتم اختيار عامل الوسم من المجموعة التي تتكون من myc-tag و FLAG-tag و His-tag و HA-tag و fluorescent protein (مثل البروتين الفلوري الأخضر (GFP)) وفلوروفور ( على سبيل المثال ، رباعي ميثيل رودامين (TRITC) ، فلورسين أيزوثيوسيانات (FITC)) ، دينيتروفينول ، مركب بروتين كلوروفيل بيريدينين ، بروتين فلوري أخضر ، فيكويريثرين (PE) ، هيستيدين ، بيوتين ، ستربتافيدين ، أفيدين ، فجل الحصان بيروكسيديز ، إنزيم الفجلوكسيتيز ، أفيدين ، Glutathione S-transferase (GST) ، بروتين رابط المالتوز ، نظائر مشعة ، وأي نوع من المركبات المستخدمة في وضع العلامات على النظائر المشعة بما في ذلك ، 1،4،7،10-tetraazacyclodecane-1،4،7،10-tetraacetic acid (DOTA) ، حمض ثنائي إيثيلين ثلاثي أمين بنتاسيتيك (DTPA) ، وحمض 1.4.7-triazacyclononane-1،4،7-triacetic acid (NOTA).

36 - طريقة لتحفيز استجابة مناعية عالمية بوساطة مستقبل مناعي في حيوان ثديي ، وهي الطريقة التي تشمل إعطاء حيوان ثديي كمية فعالة من خلية معدلة وراثيا للتعبير عن مستقبل مناعي شامل ، حيث يتألف المستقبل المناعي الشامل إما من SpyCatcher أو مجال ربط خارج الخلية SpyTag مرتبط بمنطقة المفصلة خارج الخلية ، والتي بدورها مرتبطة بمجال عبر الغشاء والذي بدوره مرتبط بمجال إشارات مستقبل الخلايا التائية داخل الخلايا.

37. طريقة الحماية 36 ، حيث يكون مجال الربط خارج الخلية SpyCatcher مرتبطًا بمجال المفصلة خارج الخلية.

38. طريقة الحماية 36 ، حيث يكون مجال ربط SpyTag خارج الخلية مرتبطًا بمجال المفصلة خارج الخلية.

39. الطريقة وفقاً لعنصر الحماية 36 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل حمض أميني مختار من المجموعة التي تتكون من رقم تعريف التسلسل: 2 ، 4 ، 6 ، 8 ، 10 ، 12 ، 14 و 16.

40. الطريقة وفقًا لعنصر الحماية 37 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل حمض أميني مختار من المجموعة التي تتكون من رقم تعريف SEQ: 6 و 8 و 14 و 16.

41. الطريقة وفقاً لعنصر الحماية 38 ، حيث يشتمل المستقبل المناعي الشامل على تسلسل حمض أميني مختار من المجموعة التي تتكون من رقم تعريف SEQ: 2 ، 4 ، 10 و 12.

42. طريقة الحماية 38 ، حيث يشتمل المستقبل المناعي الشامل أيضًا على مجال داخل الخلايا لجزيء تكلفة.

43. الطريقة وفقاً لعنصر الحماية 42 ، حيث يتم اختيار المجال داخل الخلايا لجزيء تكلفة التكلفة من المجموعة المكونة من CD27 ، CD28 ، CD2 ، CD3 ، 4-1BB ، OX40 ، CD30 ، CD40 ، PD-1 ، ICOS ، وظيفة الخلايا الليمفاوية- المستضد المرتبط 1 (LFA-1) ، CD7 ، LIGHT ، NKG2C ، B7-H3 ، يجند يرتبط على وجه التحديد بـ CD83 ، وأي توليفة منها.

44. طريقة المطالبة 38 ، حيث يتم تحفيز الاستجابة المناعية الشاملة بوساطة مستقبل المناعة عندما يرتبط المستقبل المناعي العالمي المعزول بتركيبة تشتمل إما على SpyTag- أو جزيء مرتبط بـ SpyCatcher.

45. الطريقة وفقاً لعنصر الحماية 44 ، حيث يشتمل الجزيء المرتبط بـ SpyTag أو SpyCatcher على واحد على الأقل يتم اختياره من المجموعة التي تتكون من قليل النوكليوتيد ، جسم مضاد ، جزء جسم مضاد ، scFv ، سقالة بروتين ، ببتيد ، مستقبل ، يجند ، aptamer ، عامل وضع العلامات ، مستضد الورم ، مستضد ذاتي ، مستضد فيروسي ، وأي توليفة منها.

46. ​​طريقة الحماية 45 ، حيث يتم اختيار عامل الوسم من المجموعة التي تتكون من myc-tag ، و FLAG-tag ، و His-tag ، و HA-tag ، وبروتين فلوري (مثل البروتين الفلوري الأخضر (GFP)) ، وفلوروفور (على سبيل المثال ، رباعي ميثيل رودامين (TRITC) ، فلورسين أيزوثيوسيانات (FITC)) ، دينيتروفينول ، مركب بروتين كلوروفيل بيريدينين ، بروتين فلوري أخضر ، فيكويريثرين (PE) ، هيستيدين ، بيوتين ، ستربتافيدين ، أفيدين ، فجل الفجل بيروكسيديز ، أفيدينز أوكسيديز ، الجلوتاثيون S-ترانسفيراز (GST) ، بروتين رابط المالتوز ، نظائر مشعة ، وأي نوع من المركبات المستخدمة في وضع العلامات على النظائر المشعة ، بما في ذلك ، 1،4،7،10-tetraazacyclodecane-1،4،7،10-tetraacetic acid (DOTA) ) ، حمض ثنائي إيثيلين ثلاثي أمين بنتاسيتيك (DTPA) ، وحمض 1.4.7-triazacyclononane-1،4،7-triacetic acid (NOTA).

47. طريقة الحماية 38 ، حيث تشتمل الطريقة على إعطاء إما جزيء مرتبط بـ SpyTag أو SpyCatcher للثدييات قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

48. طريقة الحماية 38 ، حيث تشتمل الطريقة على إعطاء مجموعة من الجزيئات المرتبطة بـ SpyTag أو SpyCatcher للثدييات قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

49. طريقة الحماية 38 ، حيث تشتمل الطريقة على الإدارة المتسلسلة لمجموعة من الجزيئات المرتبطة بـ SpyTag أو SpyCatcher للثدييات قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

50. طريقة الحماية 38 ، حيث تشتمل الطريقة على ربط المستقبل المناعي الشامل بجزيء مرتبط بـ SpyTag أو SpyCatcher قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

51. طريقة الحماية 38 ، حيث تشتمل الطريقة على ربط المستقبل المناعي الشامل بمجموعة من الجزيئات المرتبطة بـ SpyTag أو SpyCatcher قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

52. الطريقة وفقاً لعنصر الحماية 38 ، حيث تشتمل الطريقة على الارتباط المتسلسل للمستقبل المناعي الشامل بمجموعة من الجزيئات المرتبطة بـ SpyTag أو SpyCatcher قبل إعطاء الخلية المعدلة وراثيًا للثدييات.

53. طريقة المطالبة 38 ، حيث تكون الخلية عبارة عن خلية ذاتية.

54. الطريقة وفقاً لعنصر الحماية 38 ، حيث يتم اختيار الخلية من المجموعة التي تتكون من خلية T ، خلية قاتلة طبيعية (NK) ، خلية ليمفاوية T سامة للخلايا (CTL) ، بلاعم ، خلية جذعية ، وخلية T تنظيمية .

55. طريقة لعلاج حيوان ثديي محتاج إليها ، الطريقة التي تشمل إعطاء الثدييات كمية فعالة من الخلية حسب عنصر الحماية 23.

56. طريقة الحماية 36 ، حيث يتم علاج الثدييات من اضطراب مختار من مجموعة تتكون من عدوى فيروسية ، جرثومية وطفيلية ، ومرض مناعة ذاتية وسرطان.

57. طريقة الحماية 55 ، حيث يتم علاج الثدييات من اضطراب مختار من مجموعة تتكون من عدوى فيروسية ، جرثومية وطفيلية ، مرض مناعي ذاتي وسرطان.


التعليق

معلومات اساسية

ظهرت تفاعلات بروتين الببتيد المشفرة وراثيًا كطريقة قوية للاقتران الحيوي. جنبًا إلى جنب مع طرق الاقتران الأخرى ، مثل الربط الكيميائي الأصلي ، والربط بوساطة الإنزيم ، والربط بوساطة الانقسام ، فإنها توفر طرقًا متعددة الاستخدامات للاقتران الحيوي ، ومنح البروتينات خصائص جديدة وتمكين التطبيقات الجديدة. إن كيمياء SpyTag / SpyCatcher المعروفة هي المعيار الذهبي لهذه الأنواع من التفاعلات (Keeble & Howarth ، 2019). يكون التفاعل متساويًا ، معياريًا ، انتقائيًا كيميائيًا بدرجة عالية ، ومردودًا عاليًا ، وله مسار تفاعل واحد فقط. يمكن أن تتحمل أيضًا نطاقًا واسعًا نسبيًا من درجات الحرارة (4 درجات -37 درجة مئوية) ودرجة الحموضة (5-8) ، ويمكنها أيضًا تحمل المنظفات الخفيفة أو بعض العوامل المفسدة. لقد ألهمت القوة مفهوم "كيمياء النقر المشفرة وراثيًا" (Sun & Zhang ، 2017 ، 2020). تم تطوير التفاعل بشكل أكبر إلى الجيلين الثاني والثالث مع الخواص الحركية المحسنة بشكل كبير والتي تبلغ 28 ضعفًا و 400 ضعفًا أسرع من الزوج الأصلي (Keeble et al. ، 2017 2019). تجعل الميزات التالية هذه الطريقة جذابة للغاية في الاقتران الحيوي: (1) تحدث الكيمياء تلقائيًا على البروتينات المعبر عنها في البيئات الخلوية ، ولا يلزم إجراء أي تعديل (2) يمكن تصنيع SpyTag القصير (بطول 13 حمضًا أمينيًا) عبر ببتيد الحالة الصلبة التوليف لتسهيل الاقتران الأصلي لمجموعة متنوعة من الركائز و (3) يسهل ربط السلسلة الجانبية تخليق البروتينات غير الخطية ، مثل البروتينات على شكل شرغوف ، والبروتينات على شكل H (Zhang و Sun و Tirrell و Arnold ، 2013) ، والذي يمكن أن يمنح تأثيرات متعددة التكافؤ ويعزز استقرار البروتينات. ومن ثم ، فقد شهدت بالفعل العديد من التطبيقات في العلاجات ، والمواد الحيوية ، والتشخيص ، وتطوير اللقاحات (Brune et al. ، 2016 ، 2017 Bruun ، Andersson ، Draper ، & Howarth ، 2018 Leneghan et al. ، 2017 Schoene ، Bennett ، & Howarth ، 2016). ميزة إضافية لهذه الكيمياء هي أن هناك بالفعل مجموعة من هذه التفاعلات ، لكل منها تسلسل مميز وخصوصية وكفاءة ، مما يسمح بتشفير نفس التفاعل برموز مختلفة. على سبيل المثال ، تم تطوير الزوج التفاعلي SnoopTag / SnoopCatcher أيضًا من مجال D4 لبروتين RrgA من الالتهاب الرئوي العقدية (فيجيانيا وآخرون ، 2016). تفاعل SnoopTag / SnoopCatcher و SpyTag / SpyCatcher متعامد بشكل متبادل مع بعضهما البعض ، مما يعني أنهما يستطيعان فقط التعرف على شريكهما المعرفي ولا يتداخلان مع بعضهما البعض. ومع ذلك ، نظرًا لأن هذا النوع من الزوج التفاعلي يعتمد على إعادة التكوين لاكتساب خصوصية التسلسل وتشكيل الببتيد التحفيزي التلقائي ، فهناك دائمًا "ندبة" (المركب المعاد تكوينه) على الاتحاد. المركب المتبقي ∼15-كيلو دالتون غير مهمل ، وقد يفرض مخاوف بسبب الاستجابة المناعية غير المواتية أو تعقيد العلاقة بين التركيب والممتلكات.

لمعالجة هذا الأمر ، تم أيضًا تطوير أنظمة ربط ثلاثية المكونات ، مثل SpyTag / KTag / SpyLigase (Fierer et al. ، 2014) و SnoopTag / DogTagJr / SnoopLigase (بولدون وآخرون ، 2018). يرتبط جزء البروتين مع العلامتين ويحفز تكوين الأيزوببتيد بين علامتين بشكل لا رجعة فيه. باستخدام SpyTag / KTag / SpyLigase و Howarth وزملاء العمل بلمرة الأجسام ذات الكفاءة المعتدلة في وجود مرافق كيميائي ، TMAO. تم استخدام هذه الطريقة أيضًا لإنشاء متقارن للأجسام المضادة (Siegmund ، Piater ، Fischer ، Kolmar ، 2019 Siegmund et al. ، 2016). أبلغت مجموعتنا بشكل مستقل عن نظام ربط بديل ثلاثي المكونات ، وهو نظام SpyTag / BDTag / SpyStapler ، والذي يُظهر كفاءة أفضل حتى في حالة عدم وجود TMAO. لقد سهل تخليق البروتينات الطوبولوجية المختلفة (على سبيل المثال ، البروتينات الحلقية والبروتينات المتفرعة) عن طريق الربط الخاص بالموقع عبر ترابط الأيزوببتيد ، مع عوائد ممتازة (Wu et al. ، 2018). علاوة على ذلك ، من خلال الإدخال العقلاني للتشابك الاصطناعي في مجمع SpyTag / BDTag / SpyStapler عن طريق إعادة الأسلاك ، نجحنا في تطوير توليف القالب النشط لبروتين heterocatenanes ، والذي يمثل وضعًا جديدًا تمامًا للاقتران الحيوي عن طريق الترابط الميكانيكي (Da & Zhang ، 2019). لا يوجد ارتباط تساهمية بين المكونين ، لكن لا يمكن فصلهما دون كسر الروابط التساهمية. والجدير بالذكر أن الاقتران عن طريق التسلسل يعزز استقرار البروتينات ضد تحلل البروتينات والتكشف الحراري والذوبان الميكانيكي الناجم عن التجميد عن طريق التقييد التوافقي (Wang & Zhang ، 2017 ، 2019). في بعض الحالات ، يمكن أن تساعد التأثيرات المتعددة التكافؤ والتآزر بين البروتينات المكونة في زيادة نشاط البروتينات. علاوة على ذلك ، يمكن تحقيق هذا الاقتران الحيوي مباشرة في الخلايا أثناء التعبير ، وهو متوافق تمامًا مع الاستراتيجيات الهندسية التقليدية الأخرى للأدوية البروتينية ، مثل PEGylation ، لتحسين الأداء العلاجي. تجعل هذه الميزات الطريقة جذابة في صناعة المستحضرات الصيدلانية لتحسين أداء الحرائك الدوائية لعقار بروتيني.

معلمات حرجة

رد فعل الرقم الهيدروجيني

يعتبر الرقم الهيدروجيني للتفاعل عاملاً مهمًا في البروتوكول الأساسي 1. يمكن أن يحدث التفاعل عند درجة الحموضة 7.4 ، ولكنه سيظهر كفاءة أفضل عند درجة حموضة حمضية قليلاً (∼6.0).

درجة حرارة التفاعل

درجة حرارة التفاعل هي اعتبار مهم آخر. يظهر الاقتران كفاءة أفضل عند درجة حرارة منخفضة. من بين الظروف المختبرة ، درجة الحرارة المثلى للتفاعل هي 4 درجات مئوية. ستنخفض كفاءة التفاعل بشكل كبير عندما يتم إجراء التفاعل عند 37 درجة مئوية.

موقع الاقتران وهيكل البروتين المستهدف

بالنسبة للبروتوكول الأساسي 1 ، في حين أن الاقتران عبر ربط الأيزوببتيد ليس حساسًا بشكل عام لموقع التسلسل التفاعلي ، فإن المجموعات المجاورة تمارس تأثيرًا معينًا. لقد لوحظ أنه عندما تكون نطاقات البروتين المجاورة مضطربة ، يكون هناك عائق فاصل كبير للتفاعل: عندما تكون نطاقات البروتين المجاورة مطوية جيدًا ، سيعتمد العائق الفراغي على المسافة من البروتينات المطوية ووقت التسلسل التفاعلي SpyTag يقتصر على منطقة الحلقة ، فإن الشكل غير المواتي للربط مع SpyCatcher يمكن أن يلغي التفاعل تمامًا (Wu، Wei، & Zhang، 2018). بشكل عام ، عندما يتم كبت التفاعل ، يمكن أن تساعد إضافة SpyStapler و TMAO في تعزيز التفاعل بشكل أكبر. بالنسبة للبروتوكول الأساسي 2 ، يجب أن يكون طرفا POI في نفس الاتجاه وقريبان من بعضهما البعض مكانيًا لتفضيل التدوير والتسلسل. إذا كان الطرفان متعاكسان وبعيدان عن بعضهما البعض ، فسيكون من الصعب على العلامتين الاقتراب من التفاعل والتدوير عبر "القالب النشط". وتجدر الإشارة أيضًا إلى أن موقع العلامات التفاعلية (BDTag و SpyTag) يجب أن يكون محددًا للبروتوكول الأساسي 2. يجب وضع BDTag عند الطرف N من POI ، بينما يجب أن يكون SpyTag عند الطرف C. قد يؤدي تبادل موقع العلامتين إلى إعاقة إعادة التركيب الصحيح ، ويمكن أن يحدث التدحرج فقط ، دون تكوين الرابطة الميكانيكية.

استكشاف الأخطاء وإصلاحها

يسرد الجدول 1 المشكلات الشائعة مع البروتوكول الأساسي 1. يسرد الجدول 2 المشكلات الشائعة التي تمت مواجهتها عند اتباع البروتوكول الأساسي 2.

أضف TMAO (على سبيل المثال ، 1.5 م). إطالة وقت رد الفعل إلى 12 ساعة على الأقل. اضبط موضع SpyTag و BDTag في الإنشاء للحصول على تعرض أفضل.

حاول تقليل تركيز إيميدازول في محلول شطف (على سبيل المثال ، 100 مم) أو استخدم شطف متدرج مع زيادة تركيز إيميدازول. تنقية في ظل ظروف تغيير الطبيعة ، ثم التغيير إلى المخزن المؤقت للتفاعل.

أضف بنية β-turn أو رابطًا مرنًا للتأكد من أن العلامات التفاعلية يمكن أن تقترب من بعضها البعض وتتفاعل مع cyclize

فهم النتائج

النتائج التمثيلية للبروتوكول الأساسي 1 مبينة في الشكل 4. بالنسبة لاقتران البروتين ، يُتوقع عادةً عائد لائق يبلغ حوالي 80٪ بعد 8 ساعات ، والتي قد تختلف اعتمادًا على مواقع العلامات التفاعلية. بالنسبة لدوران البروتين ، من المتوقع أن تكون المنتجات الجانبية ، مثل أوليغومرات ممتدة السلسلة جنبًا إلى جنب مع السلائف الخطية غير المتفاعلة. في حين أن تقليل تركيز المادة المتفاعلة يمكن أن يثبط تكوينها ، يمكن إزالة معظمها باستخدام SEC. لتكوين بروتين نجمي بأربعة أذرع ، سيكون العائد 60٪ عند إضافة 3 مكافئات من SpyStapler. في وجود 1.5 مليون طن متري ، يمكن تحسين العائد إلى -80٪. بعد التفاعل ، من المحتمل أن يكون SpyStapler لا يزال مرتبطًا فعليًا بالمقارن ، لأنه يشكل معقدًا مع SpyTag و BDTag ، مما قد يفسر النطاق الخفيف لـ SpyStapler في المنتج المنقى في تحليل SDS-PAGE.

النتائج التمثيلية للبروتوكول الأساسي 2 مبينة في الشكل 6. بعد رد الفعل في المختبر ، تظهر فرقة جديدة في SDS-PAGE بوزن جزيئي أعلى.هناك بعض المواد المتفاعلة غير المتفاعلة في الخليط ، والتي يمكن إزالتها باستخدام SEC. يُظهر المنتج الخام من التوليف الخلوي المباشر لتقنيات البروتين الميكانيكية توزيعًا معقدًا للمنتج بعد IMAC ، بما في ذلك المواد المتفاعلة ، والمنتجات أحادية الحلقة ، والكاتينان غير المتجانسة ، والأوليغومرات. يمكن تنقية المنتج الرئيسي بواسطة SEC ويتم تخصيصه لبروتين heterocatenane. للحصول على أفضل النتائج ، من المفيد إجراء شطف متدرج أثناء IMAC مع زيادة تركيزات الإيميدازول قبل تنقية SEC.

اعتبارات الوقت

يمكن إكمال البروتوكول الأساسي 1 في 3 أيام: 1.5 ساعة لتحويل البلازميدات 8-12 ساعة لتحضير الثقافات البادئة 18-20 ساعة لتعبير البروتين ∼5 ساعة لتنقية البروتين 10-14 ساعة لتحضير العينة والتفاعل و ∼4 ساعة لتنقية وتوصيف المنتجات.

يمكن إكمال البروتوكول الأساسي 2 في 3 أيام. يتطلب تحويل البلازميدات وتحضير الثقافات البادئة 9-13 ساعة. يستغرق تعبير البروتين من 22 إلى 24 ساعة. هناك حاجة إلى 5 ساعات أخرى لتنقية البروتينات. ∼22 ساعة مطلوبة لتحضير العينة والتفاعل. يتم استخدام حوالي 4 ساعات لتنقية المنتجات وتوصيفها.

شكر وتقدير

نحن ممتنون للدعم المالي المقدم من المؤسسة الوطنية للعلوم الطبيعية في الصين (رقم 21925102 ، 21991132 ، 92056118) ، البرنامج الوطني للبحث والتطوير في الصين (رقم 2020YFA0908100) ، مؤسسة العلوم الطبيعية لبلدية بكين (رقم L182003) ، بكين المختبر الوطني للعلوم الجزيئية (BNLMS-CXXM-202006) ، ومشروع الطب السريري بلس X التابع لجامعة بكين ، وصناديق البحوث الأساسية للجامعات المركزية.

الكاتب الاشتراكات

Xiao-Di Da: تنظيم البيانات ، التحقيق ، المسودة الأصلية للكتابة ، Xia-Ling Wu: تنظيم البيانات ، مراجعة الكتابة والتحرير ، Yajie Liu: تنظيم البيانات ، مراجعة الكتابة والتحرير ، Wen-Bin Zhang: وضع المفاهيم ، اكتساب التمويل ، المنهجية ، إدارة المشروع ، الإشراف ، مراجعة الكتابة والتحرير

بيان تضارب المصالح

الكتاب تعلن أي تضارب في المصالح.


2. مجالات التطبيق

2.1 ترسيخ على الأسطح أو الجسيمات

للارتباط بالخرز المغناطيسي ، تم عرض ميزة التثبيت الموجه بوساطة SpyTag للأجسام المضادة أحادية المجال ، عند مقارنتها بالارتباط غير المحدد عن طريق التنشيط الكيميائي للأحماض الكربوكسيلية (الشكل 2 أ). 10 تم تطبيق التثبيت بوساطة SpyTag لتفعيل البروتين لمجموعة من الأسطح ، بما في ذلك الجسيمات النانوية الذهبية 11 والنقاط الكمومية 12 (الشكل 2 أ). تم تطوير التثبيت على طبقة واحدة من الجرافين باستخدام SpyTag لتحسين تحديد بنية المجهر الإلكتروني بالتبريد بدقة ذرية. 13 يمكن ربط البروتينات المرتبطة بـ SpyTag بجزيئات السيليكا المُجمَّعة من خلال المحاكاة الحيوية بالسيليكون 14 أو بجزيئات بلاستيكية (polyhydroxyalkanoate ، PHA) مُصنَّعة داخل الخلية 15 (الشكل 2 أ).

الصورة 2 التثبيت والاستثارة المتجانسة باستخدام تقنية التجسس. (أ) رسم تخطيطي للتثبيت غير الموجه للبروتين إلى حبة (يسار) مقابل رسو بوساطة SpyTag / SpyCatcher الموجه (يمين). يتم عرض الأسطح المختلفة التي تم جسرها باستخدام تقنية التجسس. PHA = بولي هيدروكسي ألكانات. (ب) قوة التحليل الطيفي باستخدام إرساء SpyTag. مخطط عينة للربط الاتجاهي لبروتين مهم (أخضر) بين ملاقط سطحية ومغناطيسية ، باستخدام نطاقات SpyTag و HaloTag و spacer ، للسماح بتكرار اختبارات الطي والفتح. (ج) صندوق أدوات التكاثر المتماثل. قد يتم دمج SpyAvidins أو الملفات الملفوفة أو جزيئات البروتين النانوية وراثيًا في SpyCatcher (تم تمييزها كنقطة زرقاء لسهولة التصور). تسمح إضافة يجند SpyTag المصهور باختبار كيفية تغيير حالات multimerisation المختلفة للتأثيرات البيولوجية.

لاستهداف واجهة الهواء / الماء ، أوضحت مجموعة Lynne Regan كيف لا يزال بإمكان hydrophobins تشكيل طبقة أحادية في هذه الواجهة عند ربطها بـ SpyTag. يمكن لـ Hydrophobin-SpyTag أيضًا تجميع البروتينات المهمة حول قطرات الزيت ، حيث تظل الجزيئات أحادية الانتشار لأسابيع في درجة حرارة الغرفة. يمكن نوى 17 فقاعات هواء داخل الخلايا بكبسولات نانوية صوتية مشفرة وراثيًا ، والتي يمكن تزيينها باستخدام SpyTag / SpyCatcher وتوفير مجسات للموجات فوق الصوتية المستهدفة. 18

لمعالجة عدم الدقة في الارتباط بوساطة الأمين ، تم دمج البروتينات وراثيًا في ببتيد AviTag وتم تخليقها بيوتينيلات على وجه التحديد باستخدام BirA. يمكن بعد ذلك إقران 19،20 بروتينات معالجة بالبيوتين مع الأسطح المرتبطة بالستربتافيدين ، نظرًا لأن الستربتافيدين: البيوتين هو أحد أقوى التفاعلات غير التساهمية. ومع ذلك ، فإن ارتباط الستربتافيدين / البيوتين ليس غير قابل للانعكاس ، وقد لا يكتمل تفاعل 21 BirA ، ويضيف البروتين الحيوي خطوتين إلى أي خط أنابيب: (1) إجراء تفاعل biotinylation ، و (2) إزالة البيوتين الحر لتجنب المنافسة على الستربتافيدين مواقع الربط. انعكاس الستربتافيدين: يعتبر البيوتين مشكلة حادة عندما يتم تطبيق القوة على التفاعل (على سبيل المثال ∼60 pN لـ & gt 1 دقيقة عند دراسة تكشف البروتين) ، 22 عند درجات حرارة مرتفعة ، أو للتخزين طويل الأجل. سعى الباحثون الذين يدرسون الاعتماد على القوة لتفاعلات البروتين وطي البروتين إلى تفاعل مقاوم للقوة وغير قابل للتمدد. تمتد رابطة isopeptide بين Lys بالقرب من الطرف N لـ SpyCatcher إلى Asp في الطرف C لـ SpyTag ، بحيث تمر القوة عبر رابطة isopeptide ولا تتكشف بقية مجال SpyCatcher. 23،24 لذلك ، أصبح SpyTag / SpyCatcher أداة شائعة لتحليل طيف القوة ، 1 مكملًا للتفاعل التساهمي لـ HaloTag مع روابط هاليد الألكيل 22 (الشكل 2 ب). يمكن دمج البروتينات الخاصة بالتمدد مع SpyTag في أي موقع يمكن الوصول إليه وعادةً ما يتم ربط SpyCatcher بالطور الصلب من خلال N-terminal Cys (الشكل 2 ب). تم تطبيق هذا التمدد المرتبط بـ SpyTag ، على سبيل المثال ، لاختبار الأساس الميكانيكي للسمع البشري 25 أو لدراسة مسار الطي لبروتينات الغشاء المصممة حسابياً. 26 يمكن قياس القوة بعد تثبيت SpyTag باستخدام مجهر القوة الذرية (AFM) أو ملاقط بصرية أو ملاقط مغناطيسية. 27

2.2 السيطرة على حالة البروتين المتعدد

يمكن الوصول إلى التجميعات منخفضة التكافؤ مع تناظر ثنائي السطوح من خلال "SpyAvidins" (الشكل 2C). لقد أظهرنا أنه يمكن دمج وحدات الستربتافيدين الفرعية مع SpyCatcher و tetramers الكيميرية التي تم إنشاؤها باستخدام نسخ SpyCatcher 1 أو 2 أو 3 أو 4 بدقة. وبالتالي ، يمكن تجميع الروابط ، وكذلك ربطها بروابط المعالجة الحيوية.

للوصول إلى التكافؤات المنخفضة الأخرى باستخدام التناظر الدوري ، قمنا بإعداد مجموعة من هياكل الملفات الملفوفة ، و 7 هياكل تسخير معروفة في الطبيعة أو تم تصميمها حسابيًا بواسطة مجموعة Dek Woolfson 32 (الشكل 2C). قمنا بتطبيق مجموعة الملف الملفوف هذه ، من dimer حتى heptamer ، لمتابعة اعتماد التكافؤ لتفعيل مستقبل الموت 5 لموت الخلايا المبرمج. 7

للوصول إلى قيم تكافؤ أعلى ، استخدمنا نحن وآخرون بنى بروتين عشري الوجوه (الشكل 2 ج). SpyCatcher المندمج مع Dodecin من Mycobacterium tuberculosis هو 12 مير مستقر ، والذي يمكن أن يقترن كميًا بروابط SpyTag المدمجة. 33 يحتوي Ferritin المرتبط بـ SpyCatcher على 24 وحدة فرعية ، وقد تم استخدامه في المستضدات الورمية المتعددة. 34 SpyCatcher-mi3 هو نسخة معدلة من 60-mer المصمم حسابيًا ، والذي يعبر بكفاءة في Escherichia coli ويسمح بالاقتران البسيط مع مستضدات الملاريا في مرحلة الدم ومنع انتقال العدوى. 35 SpyCatcher-AP205 ، استنادًا إلى قفيصة فج ، تحتوي على 180 وحدة فرعية ويمكن أن تقترن بمستضدات مرتبطة بفيروس نقص المناعة البشرية والسل والسرطان. 36،37 تجمُّع الجزيئات الشبيهة بالفيروسات يؤدي إلى زيادة كبيرة في الاستمناع وقد يعزز تطوير اللقاح لمجموعة من الأمراض 9 (الشكل 2 ج). تم أيضًا تطبيق هذا التجميع المستند إلى SpyTag على الأجزاء الدقيقة البكتيرية 38 أو الفيروسات الحية ، على سبيل المثال الورم الهربس البسيط ، 39 الفيروسات الخيطية Potato Virus X 40 و Tobacco Mosaic Virus ، 41 lentivirus 42 أو Adeno-related Virus (AAV). 43،44 هنا يوجد اهتمام خاص بتغيير الانتثار الفيروسي ، بما في ذلك إعادة توجيه الفيروس إلى الأورام.

بالنسبة للأجهزة المتعددة التي يمكن أن تمتد إلى ما لا نهاية ، كان الأسلوب الأول باستخدام SpyTag هو الألياف 1D المصنوعة من بروتين تكوين الأميلويد البكتيري CsgA. تم إفراز 45،46 CsgA-SpyTag بواسطة E. coli لتشكيل مادة حية وتوليد ألياف نانوية مزينة بجسيمات نانوية ذهبية أو نقاط كمومية. 46 تشكل الألياف شبكات أميلويد ذات ثبات شديد: أظهر مختبر جوشي كيف يمكن عزل CsgA-SpyCatcher من الإشريكية القولونية كحصيرة نانوية ، والبقاء على قيد الحياة مع الغسيل بالمذيبات العضوية وكبريتات دوديسيل الصوديوم (SDS) ، وبعد ذلك لا يزال يتفاعل مع SpyTag- الاندماج. 47 أسطح ثنائية الأبعاد قابلة للوظيفة عبر SpyTag (إما في المختبر أو تغطي الخلايا الحية) جاءت من الاندماج إلى بروتينات الطبقة S. تم تجميع 48 بنية ثلاثية الأبعاد تطبق SpyTag / SpyCatcher لأول مرة بواسطة مجموعات David Tirrell و Frances Arnold: تتشكل الهلاميات المائية عند خلط بروتين واحد يحمل العديد من SpyTags مع بروتين آخر يحمل العديد من SpyCatchers. 49 مكّن هذا الهلام من تغليف الخلايا الجذعية على عكس الكيماويات الأخرى لتشكيل الهيدروجيل ، يمكن تشغيل كل مكون بدقة (على سبيل المثال مع مواقع ربط إنتغرين أو مواقع انقسام بروتين ميتالوبروتينيز المصفوفة) ويؤدي التفاعل المتعامد الحيوي إلى قابلية عالية لأنواع الخلايا المختلفة. يمكن أيضًا تجميع 49 شبكة ثلاثية الأبعاد بعد الاقتران الكيميائي لـ SpyTag بالبوليمرات ، لشبكات البولي إيثيلين جلايكول (PEG) المرتبطة بتشكيل جذري بفعل الضوء. 50

2.3 مضاعفة وظيفة البروتين

- زيادة تعقيد الطي.

- عدم تطابق في حالة multimerisation لكل وحدة.

- اشتراط إجراء تعديلات كيميائية مختلفة بعد متعدية أو صناعية لكل جزء. 9

لذلك هناك العديد من المواقف التي يفضل فيها الاقتران المعياري. هذا أمر ملح بشكل خاص بالنظر إلى الثورات في Omics والطب المخصص ، حيث يبحث الناس عن أساليب قابلة للتطوير ليتم تطبيقها على 1000 إلى 100000 هدف. على سبيل المثال ، كان لمشروع البروتين البشري هدف منذ فترة طويلة يتمثل في كواشف ارتباط محددة لكل بروتين في البروتين البشري. 51 لكل من كواشف 20000 ، قد يرغب المرء في نسخة مرتبطة بـ على سبيل المثال 8 فلوروفورات مختلفة وكذلك مسبار ل ELISA والتصوير في الجسم الحي (الشكل 3 أ). مع الاندماج الجيني ، يتطلب المرء 20000 × 10 بنيات ليتم استنساخها والتعبير عنها وتنقيتها ، وهو أمر غير عملي حتى بالنسبة لأكبر شركة. مع اقتران معياري ، يتطلب المرء 20000 + 10 بنيات (الشكل 3 أ). تم وضع هذا المفهوم موضع التنفيذ باستخدام مزيج من النسخ والترجمة في المختبر خالٍ من الخلايا ، حيث تم مضاعفة كواشف الربط المرتبطة بـ SpyTag مع بروتينات الفلورسنت المرتبطة بـ SpyCatcher أو الإنزيمات أو السموم (الشكل 3 أ). 52 طور مختبر Ron Geyer هذا المفهوم لتعدد إرسال تنسيقات الأجسام المضادة. 53 تم استخدام التجميع المعياري باستخدام SpyTag / SpyCatcher أيضًا لإنشاء روابط غير متجانسة تربط إما مستقبلات سطح الخلية المختلفة 54 أو مناطق مختلفة من نفس المستقبلات. 55

تين. 3 الجمع بين الوظائف باستخدام تقنية التجسس. (أ) زخرفة الجسم المضاد الاندماجي. يمكن خلط مكتبة الموثق التي تحمل SpyTag مع مكتبة من المستجيبات التي تحمل SpyCatcher ، مما يؤدي إلى التوسع السريع في الخصائص الوظيفية. (ب) شلال متعدد الإنزيمات من تجميع Spy و Snoop. يقوم CsgA-SpyTag بتشكيل خيوط تمتد من سطح الخلية. تعمل الخيوط كمرحلة صلبة ، مما يسمح بالاقتران المتسلسل للإنزيمات لتحلل الكيتين باستخدام تفاعل متعامد لـ SpyTag / SpyCatcher و SnoopTag / SnoopCatcher. GlcNAc = N -acetylglucosamine GlcN = الجلوكوزامين. (ج) مجموعة LED بيضاء. يتم ربط 3 بروتينات فلورية مختلفة عن طريق SpyTag / SpyCatcher وتفاعل SnoopTag / SnoopCatcher ، مما يتيح نقل طاقة الرنين الفعال (FRET). يؤدي التغليف في مصفوفة والإضاءة عند 400 نانومتر إلى انبعاث ضوء أبيض محايد ثابت. BFP = البروتين الفلوري الأزرق eGFP = بروتين الفلورسنت الأخضر المحسن.

يمكن تحسين التجميع متعدد المكونات من خلال الجمع بين SpyTag / SpyCatcher مع زوج SnoopTag / SnoopCatcher المتعامد ، حيث طبقنا 9 خطوات ربط على مرحلة صلبة من Sepharose. تم اختبار فرق الأجسام / الأجسام النانوية الناتجة من أجل التآزر في قتل الخلايا السرطانية. 3 يمكن أيضًا استخدام CsgA amyloid كمرحلة صلبة ، للتجميع المتسلسل لمسار متعدد الإنزيمات لتحلل الكيتين (الشكل 3 ب). 56 وسعت مجموعتنا تجميع الشبكة ثلاثية الأبعاد عن طريق الاقتران الكيميائي لـ SpyTag بحمض الهيالورونيك متعدد السكاريد ، مما يسمح بتكوين الهلام بواسطة بروتين يحتوي على اثنين من SpyCatchers. باستخدام SnoopTag ، تم تشغيل هذه الهلاميات المائية بشكل مستقل مع بروتينات الالتصاق لتعديل سلوك الأجسام الشبه الكروية للورم. 57 كما أتاح الجمع بين أزواج Spy و Snoop التجميع النانوي طبقة تلو الأخرى لاستخراج اليورانيوم من مياه البحر. 58،59

لمعالجة التأثير البيئي للفسفور التقليدي للضوء الثنائي الباعث للضوء (LED) ، تم تجميع مصباح LED أبيض من خلال ربط البروتينات الفلورية المنبعثة في أجزاء مختلفة من الطيف (الشكل 3 ج). 60 وبالمثل ، لزيادة تحويل الطاقة الشمسية ، تم مؤخرًا دمج مجمعات حصاد ضوء النبات بشكل تساهمي مع مراكز التفاعل من بكتيريا التمثيل الضوئي الأرجواني لإعطاء امتصاص الضوء التكميلي. 61

2.4 مرونة الإنزيم والتجمع

الشكل 4 مرونة الإنزيم والاتصال باستخدام تقنية التجسس. (أ) يمكن أن يؤدي Cyclisation باستخدام SpyTag / SpyCatcher إلى زيادة مرونة الإنزيم. يشكل SpyTag-β-lactamase-SpyCatcher رابطة إيزوببتيد داخل الجزيئية. عند التسخين عند درجة الحرارة المحددة لمدة 10 دقائق ، تمت إزالة البروتين المجمع بالطرد المركزي وتم تحديد الجزء القابل للذوبان (يعني ± 1 sd ، n = 3 مقتبس من المرجع 63). (ب) كل إنزيم هيدروجيل. يؤدي خلط إنزيم SpyTag-tetrameric مع إنزيم SpyCatcher-dimeric إلى تكوين جيلاتين سريع ووظيفة تحفيزية مستقرة. (ج) التعرف على الركيزة بمساعدة. يقوم Sortase-SpyCatcher بتجنيد الركيزة المرتبطة بـ SpyTag بكفاءة ، مع إطلاق سراح بواسطة مسبار فيزيائي حيوي مرتبط بأوليجوجليسين. (د) تسلسل الجيل القادم. يمكن لـ SpyTag تثبيت الإنزيمات في المسام النانوية ، مع اكتشاف جزيء واحد لتسلسل الحمض النووي من تأثير ديوكسينوكليوزيد ثلاثي الفوسفات المعدل (dNTP) على التيار.

هناك طريقة أخرى لتعزيز الاستقرار والأداء وهي تغليف الإنزيمات في أقفاص البروتين. قام مختبر باميلا سيلفر بدمج إنزيمين في التخليق الحيوي للنيلي عبر SpyTag / SpyCatcher في داخل جزيئات الملتهمة النانوية MS2. عزز هذا التغليف إنتاج النيلي داخل الخلايا ، بالإضافة إلى زيادة ثبات الإنزيم بعد أسبوع واحد من 95٪ مقارنة بـ 5٪ للأنزيمات الحرة. 68 استخدم مختبر Wen-Bin Zhang مجال dimerisation و SpyTag / SpyCatcher لإنتاج بروتين كاتينان ، مما يولد اختزال ثنائي هيدروفولات مع زيادة الاستقرار الحراري ومحلل البروتين. 69

تم تجميع الهلاميات المائية أيضًا باستخدام SpyTag / SpyCatcher مع الإنزيمات نفسها كمادة للبناء. أظهرت شبكات الإنزيم هذه تحويلًا حفازًا فعالًا واستقرارًا جيدًا للتحفيز الحيوي للتدفق المستمر (الشكل 4 ب). 70،71 أدى الجمع بين 3 إنزيمات في هيدروجيل باستخدام SpyTag / SpyCatcher المرتبط بعديد ببتيدات شبيهة بالإيلاستين إلى زيادة العائد في التخليق الحيوي لفيتامين K2. 72

لتحسين أداء الإنزيم ، قد يسهل SpyTag / SpyCatcher توظيف الركيزة. يتعرف Sortase على عزر –LPXTG على بروتين ركيزة ويوجه الارتباط إلى تحقيقات تحمل قليل الغليسين (الشكل 4C). غالبًا ما يستخدم Sortase بتركيزات مماثلة لتلك الموجودة في ركائزه ويمكن أن تكون الكفاءة محدودة بسبب التقارب المنخفض لـ Sortase مع –LPXTG. باستخدام –LPXTG المرتبط بـ SpyTag و Sortase المرتبطين بـ SpyCatcher ، عزز مختبر Tsourkas هذا الالتحام الأساسي ، مما أدى إلى تحسين سرعة التفاعل والعائد (الشكل 4C). 73 تحديد الموضع الدقيق والتجميع طويل المدى مهمان أيضًا لتسلسل الحمض النووي للجيل التالي ، حيث تضع SpyTag بوليميريز الحمض النووي المجاور لثقب نانوي ويقرأ التغيير الحالي تسلسل الحمض النووي (الشكل 4 د). 74،75

2.5 التطبيقات الخلوية

الشكل 5 التطبيقات الخلوية لتقنية التجسس. (أ) تصوير التعرض السطحي أو الاتجار بالبروتين. يكتشف SpyCatcher المرتبط ببروتين أو صبغة الفلورسنت التعرض للبروتين السطحي أو الديناميكيات الخلوية بعد الالتقام الخلوي. (ب) إعادة استهداف قتل الخلية. يمكن توجيه خلايا CAR-T التي تعبر عن SpyCatcher عبر جسم مضاد مرتبط بـ SpyTag لقتل الخلايا السرطانية. (ج) المشبك المناعي المعياري. تعبر إحدى الخلايا عن علامة Strep مزدوجة ، بينما تعبر الخلية الأخرى عن SpyTag. يتم ضبط الاتصال بين الخلايا بواسطة Strep-Tactin-SpyCatcher القابل للذوبان. (د) مناعة مصفوفة بالغشاء. يمكن لبروتينات الغشاء المرتبطة بـ SpyTag الموجودة على السطح الخارجي للخلايا أو حويصلات الغشاء الخارجي أن تتفاعل مع المستضدات المندمجة بـ SpyCatcher لتحفيز استجابة مناعية قوية. (هـ) جهاز استشعار ميكانيكي للقلب بالقص واللصق. تسمح الفئران الضاربة بتعديل جهاز استشعار ميكانيكي في عضلة القلب المنفصلة. (F) رسم خرائط تفاعل الحمض النووي الريبي - البروتين. إجراء SpyCLIP ، لتسخير استقرار SpyTag / SpyCatcher لتحديد مواقع ربط الحمض النووي الريبي لبروتين مهم. (ز) إعادة تشكيل النيوكليوسومات. الارتباط المعياري لعامل النسخ بعامل إعادة تشكيل الكروماتين (Chd1 core).

لقد كان النجاح الإكلينيكي للعلاج المناعي ثورة في علاج السرطان في السنوات الأخيرة ، وذلك باستخدام إما مثبطات نقاط التفتيش أو الخلايا التائية لمستقبلات المستضد الخيمري (CAR). يتم حاليًا إنشاء 82 خلية CAR-T من خلال التنبيغ الفيروسي البطيء ، مما يتيح إعادة توجيه قتل الخلايا التائية إلى هدف خاص بالسرطان. تم اقتراح إعادة توجيه معياري لخلايا CAR-T باستخدام مجموعة ملف غير تساهمية على سطح الخلية لتنشيط الخلايا التائية القابلة للضبط (على سبيل المثال تقليل التنشيط في حالة عاصفة السيتوكين التي تهدد الحياة) أو إعادة توجيه الخلايا التائية إلى أهداف جديدة (في حالة التهرب المناعي). تم حقن 83 جسمًا مضادًا مرتبطًا بـ SpyTag في الفئران لتوجيه خلايا CAR-T المعبرة عن SpyCatcher نحو قتل سرطان المبيض (الشكل 5 ب). بالمقارنة مع الملفات الملفوفة ، يتمتع هذا النهج بالمزايا المحتملة للاستقرار العالي للتفاعل والتحليل الأسهل لاقتران الخلايا CAR-T (نظرًا لأن الاقتران ينجو من الغليان في SDS). 84

لتعزيز دراسة التفاعلات بين الخلية والخلية في الجهاز المناعي ، تم إنشاء مواد انتقالية مستقرة تحمل SpyTag مكشوفًا للسطح مثبتًا على مسافات مختلفة من غشاء البلازما (الشكل 5C). عبّرت 85 خلية مستهدفة عن بروتين سطحي يحمل علامة Strep توأم. بعد ذلك ، يمكن معالجة الأسئلة المتعلقة بالتفاعلات بين الخلية والخلية من حيث طول الترابط والتكافؤ والتقارب بطريقة معيارية (دون إنشاء مجموعة كبيرة من الحيوانات المستنسخة المنقولة بثبات) ، من خلال المعايرة في جزيء تجسير من SpyCatcher المرتبط بـ Strep-Tactin (الشكل 5 ج). 85 يمكن أيضًا تطبيق الزخرفة الغشائية لتجميع اللقاح: حويصلات الغشاء الخارجي (OMVs) من السالمونيلا الموهنة التي تعرض ناقلًا ذاتيًا للإشريكية القولونية المرتبطة SpyTag تسهل عرض المستحضرات المناعية المرتبطة بـ SpyCatcher (الشكل 5 د). 86

فيما يتعلق بالكائنات متعددة الخلايا ، تم استخدام SpyTag في ديدان القز ، 87 درجة مئوية. قام مختبر Samantha Harris بتوليد خط فأر مع جهاز استشعار ميكانيكي للعضلات c-MyBP-C يحمل SpyTag وفيروس حفر التبغ (TEV) موقع انقسام البروتياز (الشكل 5E).فيما يتعلق بخلايا العضلات المنفصلة بالمنظفات ، تمكنت مجموعتها من قطع البروتين باستخدام بروتياز TEV ولصقه في مناطق N- الطرفية الجديدة المرتبطة بـ SpyCatcher من البروتين. 88 أعادت هذه الجراحة الجزيئية التزامن المعتمد على الكالسيوم لتقلص العضلات ، ولكنها اعتمدت على حالة الفسفرة للجزء. لقد استخدمنا أيضًا تقنية التجسس للتحقيق في التحسس الميكانيكي في العصارة الخلوية ، ودراسة نشاط تالين في الواجهة من المصفوفة خارج الخلية إلى الهيكل الخلوي. يمكن إعادة تكوين الوظيفة الخلوية للتالين المنقسم عن طريق تفاعل SpyTag003 / SpyCatcher003. 6 ومع ذلك ، فإن المتغيرات غير التساهمية لـ SpyTag003 سمحت أيضًا باستقرار ميكانيكي كافٍ لاستعادة شكل الخلية وسرعة الترحيل. من خلال إنشاء لوحة من متغيرات SpyTag003 مع تقليل تقارب SpyCatcher003 ، يمكننا بعد ذلك تحديد النقطة التي أصبح فيها التفاعل غير كافٍ. 6

تم تطبيق تقنية التجسس في العديد من التطبيقات الوراثية والتخلقية. تم تطوير SpyCLIP لرسم خريطة تفاعل بروتين RNA في الخلايا ، مع الاستفادة من تفاعل SpyTag الذي لا رجعة فيه لتقليل الخلفية وتحسين كفاءة السحب (الشكل 5F). 89 داخل النواة ، تم دمج SpyTag مع عوامل النسخ للتغيير القابل للبرمجة لموضع النوكليوزوم (الشكل 5G) 90 أو لـ Cas9 أصغر حجمًا لتحرير الجينات بوساطة CRISPR. 91


علامة البروتين

علامات البروتين هي سلاسل ببتيد مطعمة وراثيا على بروتين مؤتلف. غالبًا ما تكون هذه العلامات قابلة للإزالة بواسطة عوامل كيميائية أو بوسائل إنزيمية ، مثل تحلل البروتين أو الربط الداخلي. ترتبط العلامات بالبروتينات لأغراض مختلفة. يمكن إضافتها إلى أي من طرفي البروتين المستهدف ، لذا فهي إما طرف C أو طرف N محدد أو كلاهما محددان C و N-terminus. يتم أيضًا إدراج بعض العلامات في تسلسل الترميز للبروتين محل الاهتمام وتُعرف باسم العلامات الداخلية. [1]

يتم إلحاق علامات التقارب بالبروتينات بحيث يمكن تنقيتها من مصدرها البيولوجي الخام باستخدام تقنية التقارب. وتشمل هذه البروتينات الرابطة للكيتين (CBP) ، وبروتين ربط المالتوز (MBP) ، وعلامة Strep [2] و glutathione-S-transferase (GST). علامة poly (His) هي علامة بروتينية مستخدمة على نطاق واسع ، والتي ترتبط بالمصفوفات المعدنية.

تُستخدم علامات الذوبان ، خاصة للبروتينات المؤتلفة المعبر عنها في الأنواع التي تعاني من نقص المرافق مثل بكتريا قولونيةللمساعدة في الطي المناسب للبروتينات ومنعها من الترسب. وتشمل هذه thioredoxin (TRX) و poly (NANP). تلعب بعض علامات التقارب دورًا مزدوجًا كعامل إذابة ، مثل MBP و GST.

تُستخدم علامات الكروماتوغرافيا لتغيير الخصائص الكروماتوغرافية للبروتين لتوفير دقة مختلفة عبر تقنية فصل معينة. غالبًا ما تتكون هذه الأحماض الأمينية متعددة الأيونات ، مثل علامة FLAG.

علامات الحاتمة هي سلاسل ببتيد قصيرة يتم اختيارها لأن الأجسام المضادة عالية التقارب يمكن إنتاجها بشكل موثوق في العديد من الأنواع المختلفة. عادة ما تكون مشتقة من الجينات الفيروسية ، مما يفسر نشاطها المناعي العالي. تتضمن علامات الحلمة ALFA-tag و V5-tag و Myc-tag و HA-tag و Spot-tag و T7-tag و NE-tag. هذه العلامات مفيدة بشكل خاص في تجارب النشاف الغربي ، والتألق المناعي ، والترسيب المناعي ، على الرغم من أنها تستخدم أيضًا في تنقية الجسم المضاد.

تُستخدم علامات الإسفار لإعطاء قراءات بصرية على البروتين. GFP ومتغيراته هي علامات التألق الأكثر استخدامًا. تتضمن التطبيقات الأكثر تقدمًا لـ GFP استخدامه كمراسل قابل للطي (الفلوريسنت إذا كان مطويًا ، أو عديم اللون إن لم يكن).


الملخص

يعد الارتباط المتشابك للأشعة فوق البنفسجية والترسيب المناعي (CLIP) المقترن بالتسلسل عالي الإنتاجية من أحدث التقنيات لوصف تفاعلات البروتين والحمض النووي الريبي ، ومع ذلك تمت دراسة جزء صغير فقط من بروتينات ربط الحمض النووي الريبي (RBPs) بواسطة CLIP بسبب لإجراءاتها المعقدة والمستوى العالي من الإشارات الإيجابية الزائفة. هنا ، قمنا بالإبلاغ عن طريقة SpyCLIP التي تستخدم الارتباط التساهمي المتكون بين SpyTag و SpyCatcher المدمجين في RBP ، والتي يمكنها تحمل أقسى ظروف الغسيل لإزالة التفاعلات غير المحددة. علاوة على ذلك ، يتحايل SpyCLIP على وضع العلامات المشعة وخطوات تنقية غشاء PAGE ، ويمكن تنفيذ الإجراء بأكمله على الخرز ويمكن بسهولة التشغيل الآلي. لقد حققنا في العديد من RBPs بواسطة SpyCLIP وقمنا بإنشاء خرائط ربط RNA عالية الجودة مع إنتاجية ودقة محسنة بشكل كبير. لذلك ، فإن حجم العلامة الصغير والبروتوكول الملائم لـ SpyCLIP يوفر طريقة قوية للتوصيف الروتيني والدراسات عالية الإنتاجية لتفاعلات البروتين مع الحمض النووي الريبي.


هل تقسيم mNeonGreen2 هو الأكثر إشراقًا بين الجميع؟

"السطوع" هو ادعاء غامض يعتمد على البيئة الخلوية. إذا كنت ترغب في وضع علامة داخلية على بروتين معبر جيدًا في العصارة الخلوية من خلال طرق CRISPR في FP11، الاجابة البسيطة هي نعم". في مستوى الجزيء المفرد (عند انتهاء عملية التكميل) ، سطوع mNeonGreen21–10/11 أعلى بكثير من GFP1–10/11. ومع ذلك ، في المستوى بالجملة ، فإن كفاءة التكامل بين FP1-10 و FP11 يمكن أن تكون شظايا متغيرة إلى حد كبير ، مع GFP1–10/11 يجري ما يقرب من 100٪ ، في حين أن mNeonGreen21–10/11 أقل من 50٪. في هذه الحالة ، إذا لم تتمكن من دفع المكمل إلى التشبع من خلال الإفراط في التعبير عن FP1-10 في العصارة الخلوية (أو أي مقصورة خلوية محددة) ، فإن استخدام GFP المنقسم قد يمنحك في الواقع صورًا أفضل. بالنسبة لجميع FPs ذات اللون الأحمر المقسمة ، فهي باهتة نسبيًا. لذلك ، ما لم يتم أخذ قناتك الخضراء ، ابدأ من mNeonGreen21–10/11.

الشكل 1: قياس سطوع الجزيء الواحد لـ FPs المنقسمة ونظيراتها كاملة الطول ، مما يدل على عدم وجود اختلاف كبير بين الانقسام والطول الكامل.


التوافق بين إصدارات spytag / spycatcher - علم الأحياء

يلعب الاقتران الحيوي [1] دورًا أساسيًا في علوم الحياة وتطوير الأدوية لأنه يوفر فرصة للجمع بين المزايا التكميلية للجزيئات الحيوية مع الأدوية [2 ، 3] ، والبوليمرات [4 - 6] ، والجسيمات النانوية [7] ، ومركبات أخرى متميزة التكوين والوظيفة [8]. على هذا النحو ، فقد أصبحت مكونًا رئيسيًا للعديد من التطبيقات الكيميائية الحيوية والصيدلانية بما في ذلك تثبيت البروتين [4 ، 9] ، توصيل الأدوية [10 ، 11] والعلاج الجيني [12]. حتى الآن ، تم إنتاج معظم المركبات الحيوية باستخدام عدد قليل فقط من المركبات الكيميائية التي يمكنها المضي قدمًا بكفاءة وانتقائية في ظل الظروف الفسيولوجية. يفرض تعقيد الجزيئات الحيوية متطلبات صارمة على ظروف التفاعل التي يمكن أن تتحملها. تشمل الأمثلة الناجحة إضافة ثيول-مايكل [13] ، تفاعل ثيول-إن [14] ، الاقتران الحيوي بوساطة التيروزيناز [15]. يوسع مفهوم التفاعلات المتعامدة الحيوية صندوق الأدوات هذا. تتضمن مثل هذه التفاعلات تفتيت الحمولة الحلقية أزيد-ألكين المعزز بالإجهاد [16] ، تفاعل ديلز ألدر [3 ، 17] وتفاعل ستودينجر [18]. عادةً ما يتم تثبيت مجموعات وظيفية أجنبية عالية التفاعل على الجزيئات الحيوية عن طريق الهندسة الأيضية أو وضع العلامات الانتقائية للموقع مع المونومرات غير الطبيعية ، عادةً مع إنتاجية منخفضة من البروتين ، مما يحد من التطبيق على نطاق أوسع.

في الآونة الأخيرة ، ظهرت كيمياء بروتين الببتيد المشفر وراثيًا ، مثل تفاعل SpyTag-SpyCatcher [19 ، 20] ، كطريقة جديدة للقيام بالكيمياء بالبروتينات داخل فضاء التفاعل البيولوجي [21 ، 22]. تعتمد هذه الأزواج التفاعلية بالكامل على الأحماض الأمينية الطبيعية ويكون التفاعل متوافقًا مع الظروف الفسيولوجية ، مما يغني عن الحاجة إلى كواشف أو محفزات كيميائية إضافية [23]. علاوة على ذلك ، فهو قابل للتشفير وراثيًا ويمكن برمجته مباشرة في تسلسل البروتين. التفاعل غير حساس لموقع التسلسلات التفاعلية في السلسلة. لقد جعله الاقتران الانتقائي للغاية والسريع وغير القابل للعكس منه جذابًا للغاية لمجموعة متنوعة من التطبيقات ، مثل هندسة طوبولوجيا البروتين [24] ، وصنع اقترانات الجسيمات النانوية [25] ، وهندسة الأنظمة التحفيزية فوق الجزيئية المعقدة معماريًا [26] وما إلى ذلك. على الرغم من أن هذا هو رد فعل مثالي لصنع المركبات الحيوية ، إلا أنه لم يكن هناك سوى عدد قليل من التقارير حول استخدامه للاقتران مع المركبات غير البيولوجية [27]. نظرًا لأن SpyTag عبارة عن ببتيد مكون من 13 حمضًا أمينيًا ويمكن تحضيره عن طريق تخليق ببتيد المرحلة الصلبة ، فقد تصورنا أنه يمكن أن يكون بمثابة جسر للاقتران الأصلي بين البروتينات والمركبات الاصطناعية الأخرى. يجب أن يوفر إدخال SpyTag مقبض تفاعلي للاقتران اللاحق في ظل الظروف الأصلية.

تعتبر الفوليرينات هياكل نانوية كربونية رائعة [28]. على الرغم من أن الفوليرين الأصلي [60] (C60) أظهرت أنشطة بيولوجية محتملة ، فهي غير قابلة للذوبان في الوسط المائي وبالتالي غير مواتية للتطبيق في البيئات البيولوجية [29]. لتوسيع نطاق تطبيقه ، من المهم العثور على C قابل للذوبان في الماء60 المشتقات التي يتم تصنيعها بسهولة ويمكن ربطها بسهولة بالجزيئات الحيوية. على سبيل المثال ، الفوليرينول [C60(أوه)x] تعرض مجموعة كبيرة من تطبيقات الطب النانوي نظرًا لقابلية ذوبانها في الماء المحسنة وتأثيراتها البيولوجية المختلفة ، بما في ذلك خاصية التحسس الضوئي ، والإجهاد المضاد للأكسدة ، وكسح الجذور الحرة [30 - 32]. على الرغم من استخدامها المحتمل كعوامل مضادة لتكوّن الأوعية ، إلا أنه من الصعب زيادة فاعليتها. لقد ثبت أن الهيدروكسيل أو حمض الكربوكسيل وظيفي C60 مع الهياكل المحددة بدقة يمكن أن تكون بمثابة جزيئات نانوية جزيئية محبة للماء لدفع تجميع الاتحاد. في هذه الحالة ، لا يتم الكشف عن الطبيعة المحبة للماء حتى نزع الحماية بعد الاقتران. سيكون من المرغوب فيه للغاية تطوير لبنات بناء الفوليرين المحبة للماء لصنع المقارنات الحيوية في ظل الظروف المحلية.

في هذا الاتصال ، نُبلغ عن تصميم وتوليف وتوصيف C60- اقتران حيوي للبروتين باستخدام كيمياء SpyTag-SpyCatcher (الشكل 1) ، والتي توفر طريقة عامة وقوية لتعديل البروتينات باستخدام C60 المشتقات. من المتوقع أن يكون C60 سيؤثر بشدة على سلوك التجميع الذاتي للبروتينات والخصائص البصرية للمقارب الحيوي.

تم تقسيم الإستراتيجية التركيبية إلى خطوتين: (1) تثبيت SpyTag على C.60 تحت ظروف غير أصلية و (2) الاقتران الأصلي بين الحامل SpyTag C60 المشتقات والبروتينات الحاملة SpyCatcher. يمكن إنجاز الخطوة الأولى باستخدام cycloaddition alkyne-azide المحفز بالنحاس (I) بين C القابل للذوبان في الماء أو أزيد أو ألكين وظيفي.60 وما شابه ذلك SpyTag الوظيفية. توليف C60 تظهر المشتقات في المخطط S1 (المعلومات الداعمة). بدأت مع التفعيل الأحادي لـ C60 عن طريق تفاعل Bingel-Hirsch الذي يتحكم فيه القياس المتكافئ لتثبيت مجموعة Alkyne المحمية بـ TMS (مركب 2 أ) أو مجموعة الكلورو التي يمكن تحويلها بسهولة إلى وظيفة أزيد (مركب 2 ب). لتحقيق قابلية الذوبان في الماء المحتملة ، تم إدخال مجموعات هيدروكسيل محمية متعددة بخطوة إضافية من تفاعل Bingel-Hirsch للحصول على [1: 5] adducts (مركبات 4 ا و 4 ب). بعد ذلك ، بعد التحويل الوظيفي للمجموعة وإلغاء الحماية ، ج "قابلين للنقر"60 تم الحصول على المشتقات في غلة محترمة (مركبات 6 أ، العاصمة60-الكين و 6 ب، العاصمة603). يمكن العثور على الإجراءات التركيبية والتوصيفات التفصيلية في المعلومات الداعمة (الأشكال S1-S9 في دعم المعلومات). والجدير بالذكر أنه قبل نزع الحماية من مجموعات الهيدروكسيل ، تكون المركبات قابلة للذوبان بدرجة عالية في المذيبات العضوية الشائعة. تم إثبات تراكيب مشتقات الفوليرين [60] بواسطة أطياف 1 H NMR و 13 C NMR و IR و MALDI-TOF MS. بعد نزع الحماية ، DC60-الكين و DC603 يمكن إذابته بسهولة في الميثانول والماء.

رد فعل "النقر" بين العاصمة60-الكين وأزيد SpyTag المغطاة بنهاية (N.3-SpyTag) في الماء باستخدام CuSO4/ أسكوربات الصوديوم كعامل مساعد عند 25 لإعطاء التيار المستمر60-تجسس. تم غسيل العينة لإزالة المحفز متبوعًا بالتجفيف بالتجميد للحصول على مادة صلبة منفوشة ذات لون بني فاتح. والجدير بالذكر أن اثنين من معادلات DC60تمت إضافة -alkyne لضمان الاستهلاك الكامل لـ N3-SpyTag أثناء رد فعل النقر. فائض العاصمة60تمت إزالة -alkyne بسهولة بواسطة كروماتوجرافيا سائل البروتين السريع (FPLC) أثناء عملية التنقية. تم إثبات نجاح تفاعل النقر من خلال الاختفاء التام لامتصاص الأزيد عند 2108 سم -1 في طيف FTIR للمنتج (الشكل 2 أ). في المقابل ، تظهر سلسلة من القمم الجديدة ويمكن تخصيصها بوضوح لوجود مجموعات وظيفية جديدة ، مثل 1741 سم -1 لـ C = O و 1250 سم -1 للمجموعات - (CO) -O- في العاصمة60. العاصمة60-SpyTag قابل للذوبان بالكامل في الماء ، مما يسهل ربط التيار المستمر60 إلى أي بروتينات تحتوي على SpyCatcher في الماء باستخدام الكيمياء SpyTag-SpyCatcher.

التفاعل بين العاصمة60- تم إجراء SpyTag و SpyCatcher في المخزن المؤقت لبرنامج تلفزيوني عند 25 درجة مئوية كتفاعل اقتران نموذجي أصلي. بعد 12 ساعة ، تمت تنقية المحلول بواسطة FPLC لإزالة DC الزائد60-تجسس. بعد التحلية ، تم تجفيف المحلول بالتجميد للحصول على مادة صلبة بنية فاتحة لمزيد من التوصيف. العاصمة60-تقارن SpyTag / SpyCatcher لديه قابلية ذوبان أفضل في الماء من DC النقي60-الكين. الإعداد الناجح لل DC60- تم عرض اقتران SpyTag / SpyCatcher بشكل مقنع في طيف MALDI-TOF MS حيث لوحظ توزيع رئيسي واحد فقط في م/ض تتطابق قيمة 18547 Da بشكل جيد مع الكتلة المحسوبة البالغة 18567 Da للتيار المستمر60-SpyTag / SpyCatcher المتقارن (الشكل 2 ب). بالمقارنة مع كتلة SpyCatcher ، هناك تحول واضح في الوزن الجزيئي لـ 3916 Da ، وهو قريب من القيمة المحسوبة 3940 Da للتيار المستمر.60عزر -SpyTag ضمن خطأ تجريبي.

خصائص امتصاص الأشعة فوق البنفسجية للتيار المستمر60-SpyTag و SpyCatcher و DC60- تم توضيح متقارن SpyTag / SpyCatcher في الماء بنفس تركيز 1.0 مجم / مل في الشكل 2 ج. وقد أظهر الحد الأقصى للامتصاص النموذجي في التحليل الطيفي للأشعة فوق البنفسجية بين 200 نانومتر إلى 600 نانومتر للتيار المستمر60-تجسس. كانت ذروة الامتصاص المحددة لـ SpyCatcher عند 200 نانومتر. بداية ذروة العاصمة60تم حساب اتحاد SpyTag / SpyCatcher ليكون ∼400 نانومتر. تُظهر الصورة (الشكل 2C داخليًا) المحلول البني البرتقالي للتيار المستمر60المتقارن -SpyTag / SpyCatcher المنقى بواسطة FPLC. كل هذه تظهر أن العاصمة60الشق يضفي الخصائص البصرية على البروتين. يُظهر TEM الغشاء النانوي للتيار المستمر60-SpyTag / SpyCatcher مقترن بالتوزيع الخواص للتيار المستمر60 النقاط (المرحلة المظلمة ، الشكل 2 د). يمكن العثور على المزيد من صور التشكل في الشكل S10 (المعلومات الداعمة). لم يكن هناك طور مرتب واضح في الغشاء. ومن ثم ، اقترحنا توزيعًا جزيئيًا عشوائيًا لحساب التشكل الملحوظ كما هو موضح في الشكل الداخلي 2D.

لفحص عمومية النهج ، قمنا بتصميم بروتين ثنائي الوظيفة يحتوي على مجالات متعددة ، وهي Spy-Catcher-ELP-Dronpa-ELP-SpyCatcher (BDB). البروتين الشبيه بالإيلاستين (ELP) هو بروتين مضطرب جوهريًا [33] و Dronpa هو بروتين أخضر فلوري مستجيب للصور [34]. تم تعديل هذا التركيب من BCB في منشورنا السابق في تجميع طبقة تلو طبقة لغشاء رقيق قائم على البروتين بالكامل [35]. ببساطة عن طريق خلط BDB مع DC60-SpyTag في برنامج تلفزيوني في درجة حرارة الغرفة ، قدمنا ​​DC60 شق على طرفي البروتين وحصل على اقتران حيوي جديد يُشار إليه باسم DC60-BDB-DC60 ( رسم بياني 1 ). تم إثبات التوليف الناجح للاقتران مباشرة من خلال حركته المنخفضة والموضع الأعلى قليلاً في صورة SDS-PAGE (الشكل 3 أ). كان ملف تعريف الشطف على مخطط كروماتوجرام سائل (LC) بشكل أساسي هو نفسه سلائف BDB ، مما يشير إلى تغييرات طفيفة نسبيًا في الحجم الكلي للجزيء (الشكل 3 ب). تؤكد أطياف MALDI-TOF MS كذلك على التعلق الدقيق لاثنين من DC60 الزخارف (الشكل 3 ج). تم العثور على الوزن الجزيئي للمادة المتفاعلة BDB عند -70888 Da ، وهي قريبة من القيمة المحسوبة 70 ، 907 Da (مع الأخذ في الاعتبار فقدان جزيء ماء واحد واثنين من الهيدروجين عند نضوج الكروموفور [36]). بعد نجاح وظيفي ثنائي ، كتلة العاصمة60-BDB-DC60 تحول إلى ∼78357 Da في طيف MALDI-TOF MS ، وهو قريب من الوزن الجزيئي المتوقع البالغ 78 ، 751 دا ضمن الخطأ التجريبي في نطاق الوزن الجزيئي العالي هذا (≤ 0.5٪). علاوة على ذلك ، تم استخدام TEM أيضًا لمراقبة فصل الطور المباشر في DC60-BDB-DC60. تم تفريق العينات المجففة بالتجميد في الماء عن طريق الموجات فوق الصوتية وتم رصدها على شبكات Formvar / Carbon 200 الشبكية لتحضير عينة TEM. توفر السلاسل المرنة لـ ELP تنقلًا كافيًا للتيارين DC60 ينتهي بهم ويسهل تجميعهم الذاتي. كما هو مبين في الشكل ثلاثي الأبعاد ، يتم تخصيص المرحلة المظلمة للتيار المستمر60مرحلة غنية. يبلغ متوسط ​​قطر المرحلة المظلمة ∼7.95 نانومتر (الشكل 3E). يوضح الشكل 3F الرسم التوضيحي للتجميع الجزيئي. لاحظنا أيضًا أنه بمجرد تجميد العينة بالتجميد ، يصعب إذابة العينة في الماء مرة أخرى. ربما يمكن تفسير ذلك من خلال التشابك المادي كنتيجة للتيار المستمر60 التجميع (الشكل ثلاثي الأبعاد داخلي والشكل S11 في المعلومات الداعمة). ومن ثم ، فإن إدخال C60 في البروتينات يجلب بالفعل خصائص بصرية مثيرة للاهتمام وسلوكيات التجميع الذاتي. بالإضافة إلى ذلك ، وبحسب الأدبيات [37] ، فإن العاصمة60 يمكن أن تستهدف بنية بروتينية محددة مع آثار في الاتصال الجزيئي الحيوي الوظيفي. يشير إلى أن الاتحاد قد يعزز أو ينظم تفاعلات بروتينية معينة تتضمن التعرف على البروتين / الفوليرينول. قد تكون هذه الاتحادات مفيدة في صنع أدوية ذات اختراق أفضل للخلايا وقدرة مضادة للبكتيريا.

باختصار ، أبلغنا عن C قابل للذوبان في الماء60 مشتق يحمل SpyTag تفاعلي (DC60-SpyTag) للاقتران السهل مع البروتينات. تم نقل قابلية الذوبان في الماء إلى C60 بواسطة مجموعات هيدروكسيل متعددة. تم تثبيت SpyTag على C.60 بواسطة CuAAC ، انقر فوق الكيمياء وكانت بمثابة المقبض التفاعلي للاقتران مع أي بروتينات تحمل SpyCatcher. يتيح تفاعل SpyTag-SpyCatcher الفعال والمتوافق مع الخلايا الاقتران الأصلي بين العناصر غير البيولوجية وجزيئات البروتين. التوليف المريح للتيار المستمر القابل للذوبان في الماء60-توفر SpyTag كاشفًا متعدد الاستخدامات وفعالًا لتعديل البروتينات الخاصة بالموقع في ظل الظروف الفسيولوجية. يمكن أن يساعد في الحفاظ على الوظائف الأصلية للبروتين أثناء الاقتران الحيوي ، وهو أمر مهم بشكل خاص لتلك البروتينات التي تكون هياكلها ووظائفها حساسة للظروف غير الفسيولوجية. عدد DC60 يمكن التحكم في البروتين من خلال عدد محدد مسبقًا من وحدات SpyCatcher في تصميم البروتين. نعتقد أن الطريقة توفر وصولاً عامًا وجاهزًا إلى المركبات الحيوية البروتينية متعددة الوظائف التي تحتوي على مكونات غير بيولوجية غريبة بما في ذلك ، على سبيل المثال لا الحصر ، C60.

إعلان تضارب المصالح

يعلن المؤلفون أنه ليس لديهم مصالح مالية متنافسة معروفة أو علاقات شخصية يمكن أن يبدو أنها تؤثر على العمل المذكور في هذه الورقة

نحن ممتنون للدعم المالي من مؤسسة العلوم الطبيعية الوطنية في الصين (أرقام 21925102 و 21991132 و 21674003). تم دعم هذا العمل أيضًا من قبل مختبر بكين الوطني للعلوم الجزيئية (رقم BNLMS-CXXM-202006) ومشروع الطب السريري Plus X لجامعة بكين ، وصناديق البحوث الأساسية للجامعات المركزية.



تعليقات:

  1. Kajirr

    أشاركها تمامًا وجهة نظرها. انا اعتقد انها فكرة جيدة.

  2. Vudojora

    أنت تعطي المزيد من المعلومات.

  3. Moryn

    أهنئ ، بالمناسبة ، يحدث هذا الفكر

  4. Creketun

    وأنا أتفق تماما معك. هناك شيء في هذا وفكرة عظيمة.

  5. Catrell

    فقط بما فيه الكفاية ، سأشارك.



اكتب رسالة